The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 947
Allergen Scientific Name Fra a 1
Allergen Species - Systematic Name Fragaria ananassa
Allergen Species - Common Name Strawberry
Allergen Common source foods
Allergen Common name
Allergen Keywords Pathogenesis-related protein, PR-10
Allergen IUIS (Yes=1, No=0) 1

Fra a 1 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Fra a 1.0101
Fra a 1 - References
ID Reference
No reference found!
Fra a 1 - Protein Sequences
Source Link to source
SwissProt Q256S4
SwissProt Q256S2
SwissProt Q3T923
SwissProt Q256S6
SwissProt Q256S7
Fra a 1 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
947 302 2LPX 2012-02-20 Solution NMR major strawberry allergen Fra a 1-E
2LPX.pdb


Fra a 1 - Sequence Search :
Sequence Header Sequence
Fra a 1
SDAP Sequence ID: 1302
SDAP Allergen ID: 947
MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fra a 1
SDAP Sequence ID: 1303
SDAP Allergen ID: 947
MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fra a 1
SDAP Sequence ID: 1304
SDAP Allergen ID: 947
MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fra a 1
SDAP Sequence ID: 1305
SDAP Allergen ID: 947
MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fra a 1
SDAP Sequence ID: 1306
SDAP Allergen ID: 947
MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fra a 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Fra a 1 90.85 0.78 2LPX_A 100 160 160 1 - 160 1 - 160 0 320 Download (SI: 1303)
Fra a 1 89.9 0.78 2LPX_A 96.875 160 160 1 - 160 1 - 160 0 311 Download (SI: 1305)
Fra a 1 90.55 0.78 2LPX_A 97.5 160 160 1 - 160 1 - 160 0 315 Download (SI: 1306)
Fra a 1 89.85 0.77 2LPX_A 97.5 160 160 1 - 160 1 - 160 0 315 Download (SI: 1304)
Fra a 1 92.15 0.79 2LPX_A 97.5 160 159 1 - 159 1 - 160 0 308 Download (SI: 1302)
Fra a 1 - Alphafold Theoretical Model Structure
Model Structure
1306_relaxed_rank_1_model_2.pdb


Coverage Plddt
Fra a 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q256S4 Click here to process the data
Q256S2 Click here to process the data
Q3T923 Click here to process the data
Q256S6 Click here to process the data
Q256S7 Click here to process the data
Fra a 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1302 947 1 152 1 154 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
1303 947 1 153 1 155 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
1304 947 1 153 1 155 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
1305 947 3 153 1 155 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
1306 947 1 153 1 155 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Fra a 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.