The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 270
Allergen Scientific Name Gad c 1
Allergen Species - Systematic Name Gadus callarias
Allergen Species - Common Name cod
Allergen Common source foods
Allergen Common name
Allergen Keywords allergen M, parvalbumin beta
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Gad c 1 - References
ID Reference
Pubmed ID: 4423465
Elsayed S, von Bahr-Lindstrom H, Bennich H, The primary structure of fragment TM2 of allergen M from cod. Scand J Immunol. 1974;3(5):683-6.
Pubmed ID: 1145128
Elsayed S, Bennich H, The primary structure of allergen M from cod. Scand J Immunol. 1975;4(2):203-8.
Pubmed ID: 65337
Elsayed S, Apold J, Aas K, Bennich H, The allergenic structure of allergen M from cod. I. Tryptic peptides of fragment TM 1. Int Arch Allergy Appl Immunol. 1976;52(1-4):59-63.
Pubmed ID: 84803
Apold J, Elsayed S, Aukrust L, Bennich H, The allergenic structure of allergen M from cod. III. Studies on the antigenicity of long-sequence peptides. Int Arch Allergy Appl Immunol. 1979;58(3):337-43.
Gad c 1 - Protein Sequences
Source Link to source
SwissProt P02622
Gad c 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
142 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Gad c 1 - Sequence Search :
Sequence Header Sequence
Gad c 1
SDAP Sequence ID: 142
SDAP Allergen ID: 270
AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gad c 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Gad c 1 93.05 0.79 2MBX_A 67.925 106 113 1 - 106 2 - 107 1.65998e-41 133 Download (SI: 142)
Gad c 1 - Alphafold Theoretical Model Structure
Model Structure
142_relaxed_rank_1_model_4.pdb


Coverage Plddt
Gad c 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P02622 Click here to process the data
Gad c 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
142 270 42 102 40 106 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Gad c 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.