The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 278
Allergen Scientific Name Gal d 2
Allergen Species - Systematic Name Gallus domesticus
Allergen Species - Common Name chicken
Allergen Common source foods
Allergen Common name
Allergen Keywords Ovalbumin; Plakalbumin
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Gal d 2 - References
ID Reference
Pubmed ID: 6601671
Hoffman DR, Immunochemical identification of the allergens in egg white. J Allergy Clin Immunol. 1983 May;71(5):481-6.
Pubmed ID: 6638415
Langeland T, A clinical and immunological study of allergy to hen's egg white. IV. Specific IGE-antibodies to individual allergens in hen's egg white related to clinical and immunological parameters in egg-allergic patients. Allergy. 1983 Oct;38(7):493-500.
Gal d 2 - Protein Sequences
Source Link to source
SwissProt P01012
GenBank 212900
GenBank 808974
GenBank 808969
GenBank 212897
GenBank 63052
Gal d 2 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
278 149 1OVA 26-NOV-90 X-ray diffraction resolution 1.95 A
278 257 1UHG 2003-07-03 X-ray diffraction resolution 1.90 A
278 258 1JTI 2001-08-21 X-ray diffraction resolution 2.30 A
1JTI.pdb


Gal d 2 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
547 GetModel Model Pic Model Pic Model Pic Model Pic Click here
550 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Gal d 2 - Sequence Search :
Sequence Header Sequence
Gal d 2
SDAP Sequence ID: 144
SDAP Allergen ID: 278
GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 2
SDAP Sequence ID: 547
SDAP Allergen ID: 278
MDSISVTNAKFCFDVFNEMKVHHVNENILYCPLSILTALAMVYLGARGNTESQMKKVLHFDSITGAGSTTDSQCGSSEYVHNLFKELLSEITRPNATYSLEIADKLYVDKTFSVLPEYLSCARKFYTGGVEEVNFKTAAEEARQLINSWVEKETNGQIKDLLVSSSIDFGTTMVFINTIYFKGIWKIAFNTEDTREMPFSMTKEESKPVQMMCMNNSFNVATLPAEKMKILELPYASGDLSMLVLLPDEVSGLERIEKTINFDKLREWTSTNAMAKKSMKVYLPRMKIEEKYNLTSILMALGMTDLFSRSANLTGISSVDNLMISDAVHGVFMEVNEEGTEATGSTGAIGNIKHSLELEEFRADHPFLFFIRYNPTNAILFFGRYWSP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 2
SDAP Sequence ID: 548
SDAP Allergen ID: 278
MGSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 2
SDAP Sequence ID: 549
SDAP Allergen ID: 278
MGSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKTFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 2
SDAP Sequence ID: 550
SDAP Allergen ID: 278
QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAEKMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 2
SDAP Sequence ID: 551
SDAP Allergen ID: 278
MGSIAAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYFQCVKELYRGGLEPINFQTAADQARELINSWVESQTN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 2 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Gal d 2 91.8 0.84 6KGA_A 59.794 388 388 1 - 388 1 - 386 0 500 Download (SI: 547)
Gal d 2 94.7 0.86 1OVA_C 99.74 385 386 2 - 386 2 - 386 0 798 Download (SI: 549)
Gal d 2 92.65 0.86 1OVA_C 100 385 385 1 - 385 2 - 386 0 800 Download (SI: 144)
Gal d 2 89.8 0.79 6KGA_A 64.935 231 232 2 - 232 158 - 386 0 315 Download (SI: 550)
Gal d 2 94.5 0.88 1JTI_A 98.701 154 155 2 - 155 1 - 154 0 326 Download (SI: 551)
Gal d 2 92.45 0.85 1OVA_C 100 385 386 2 - 386 2 - 386 0 800 Download (SI: 548)
Gal d 2 - Alphafold Theoretical Model Structure
Model Structure
551_relaxed_rank_1_model_1.pdb


Coverage Plddt
Gal d 2 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P01012 Click here to process the data
212900 Click here to process the data
808974 Click here to process the data
808969 Click here to process the data
212897 Click here to process the data
63052 Click here to process the data
Gal d 2 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
144 278 6 385 5 385 PF00079 Serpin Domain No_clan Serpin (serine protease inhibitor)
547 278 8 388 6 388 PF00079 Serpin Domain No_clan Serpin (serine protease inhibitor)
548 278 7 386 6 386 PF00079 Serpin Domain No_clan Serpin (serine protease inhibitor)
549 278 7 386 6 386 PF00079 Serpin Domain No_clan Serpin (serine protease inhibitor)
550 278 1 232 1 232 PF00079 Serpin Domain No_clan Serpin (serine protease inhibitor)
551 278 7 155 6 155 PF00079 Serpin Domain No_clan Serpin (serine protease inhibitor)
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Gal d 2 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.