The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 280
Allergen Scientific Name Gal d 4
Allergen Species - Systematic Name Gallus domesticus
Allergen Species - Common Name chicken
Allergen Common source foods
Allergen Common name
Allergen Keywords Lysozyme; EC 3.2.1.17; Lysozyme C; 1,4-beta-N-acetylmuramidase C
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Gal d 4 - References
ID Reference
Pubmed ID: 6601671
Hoffman DR, Immunochemical identification of the allergens in egg white. J Allergy Clin Immunol. 1983 May;71(5):481-6.
Pubmed ID: 6638415
Langeland T, A clinical and immunological study of allergy to hen's egg white. IV. Specific IGE-antibodies to individual allergens in hen's egg white related to clinical and immunological parameters in egg-allergic patients. Allergy. 1983 Oct;38(7):493-500.
Gal d 4 - Protein Sequences
Source Link to source
SwissProt P00698
GenBank 212279
GenBank 63426
Gal d 4 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
280 22 2LYM 08-JUN-87 X-ray diffraction resolution 2.0 A
280 23 3LYM 08-JUN-87 X-ray diffraction resolution 2.0 A
280 24 4LYM 30-JUL-90 X-ray diffraction resolution 2.1 A
280 25 5LYM 20-JUL-95 X-ray diffraction resolution 1.8 A
280 26 1LYS 03-DEC-93 X-ray diffraction resolution 1.72 A
280 27 3LYT 20-MAR-92 X-ray diffraction resolution 1.9 A
280 28 4LYT 20-MAR-92 X-ray diffraction resolution 1.9 A
280 29 5LYT 20-MAR-92 X-ray diffraction resolution 1.9 A
280 30 6LYT 20-MAR-92 X-ray diffraction resolution 1.9 A
280 31 1LYZ 01-FEB-75 X-ray diffraction resolution 2.0 A
280 32 2LYZ 01-FEB-75 X-ray diffraction resolution 2.0 A
280 33 3LYZ 01-FEB-75 X-ray diffraction resolution 2.0 A
280 34 4LYZ 01-FEB-75 X-ray diffraction resolution 2.0 A
280 35 5LYZ 01-FEB-75 X-ray diffraction resolution 2.0 A
280 36 6LYZ 01-FEB-75 X-ray diffraction resolution 2.0 A
280 37 7LYZ 06-MAY-77 X-ray diffraction resolution 2.5 A
280 38 8LYZ 16-SEP-77 X-ray diffraction resolution 2.5 A
280 39 1LZH 29-JUN-81 X-ray diffraction resolution 6.0 A
280 40 2LZH 29-JUN-81 X-ray diffraction resolution 6.0 A
280 41 1LZT 01-APR-85 X-ray diffraction resolution 1.97 A
280 42 2LZT 21-AUG-89 X-ray diffraction resolution 1.97 A
280 43 3LZT 23-MAR-97 X-ray diffraction resolution 0.92 A + NO3 Ac
280 44 4LZT 31-MAR-97 X-ray diffraction resolution 0.95 A + NO3
280 45 3HFL 02-MAY-95 X-ray diffraction resolution 2.65 A complex with IgG Ab Fab
280 46 3HFM 11-AUG-88 X-ray diffraction resolution 3.0 A complex with IgG Ab Fab
280 47 1HEL 10-JAN-92 X-ray diffraction resolution 1.7 A
280 48 1HEM 10-JAN-92 X-ray diffraction resolution 1.8 A mutant S91T
280 49 1HEN 10-JAN-92 X-ray diffraction resolution 1.8 A mutant I55V,S91T
280 50 1HEO 10-JAN-92 X-ray diffraction resolution 1.8 A mutant I55V
280 51 1HEP 10-JAN-92 X-ray diffraction resolution 1.8 A mutant T40S,I55V,S91T
280 52 1HEQ 10-JAN-92 X-ray diffraction resolution 1.8 A mutant T40S,S91T
280 53 1HER 10-JAN-92 X-ray diffraction resolution 1.8 A mutant T40S
280 54 1HEW 20-JAN-92 X-ray diffraction resolution 1.75 A complex with tri-N-acetylchitotriose
280 55 1LMA 14-AUG-92 X-ray diffraction resolution 1.75 A 88 % humidity
280 56 1RCM 10-JAN-93 X-ray diffraction resolution 1.9 A carboxymethylated (6,127-rcm)
280 57 1LSA 05-JUL-94 X-ray diffraction resolution 1.7 A 120 K
280 58 1LSB 05-JUL-94 X-ray diffraction resolution 1.7 A 180 K
280 59 1LSC 05-JUL-94 X-ray diffraction resolution 1.7 A 250 K
280 60 1LSD 05-JUL-94 X-ray diffraction resolution 1.7 A 280 K
280 61 1LSE 05-JUL-94 X-ray diffraction resolution 1.7 A 295 K
280 62 1LSF 05-JUL-94 X-ray diffraction resolution 1.7 A 95 K
280 63 1LSM 13-SEP-94 X-ray diffraction resolution 1.7 A mutant I55L,S91T,D101S
280 64 1LSN 13-SEP-94 X-ray diffraction resolution 1.9 A mutant S91A
280 65 1LZA 10-FEB-95 X-ray diffraction resolution 1.6 A
280 66 1LZB 10-FEB-95 X-ray diffraction resolution 1.5 A complex with tri-N-acetylchitotriose
280 67 1LZC 10-FEB-95 X-ray diffraction resolution 1.8 A complex with tetra-N-acetylchitotetraose
280 68 1LZD 10-FEB-95 X-ray diffraction resolution 1.8 A mutant W62Y
280 69 1LZE 10-FEB-95 X-ray diffraction resolution 1.8 A mutant W62Y, complex with tri-N-acetylchitotriose
280 70 1LZG 10-FEB-95 X-ray diffraction resolution 1.8 A mutant W62F, complex with tri-N-acetylchitotriose
280 71 1FDL 27-AUG-90 X-ray diffraction resolution 2.5 A complex with IgG Ab Fab
280 72 1JPO 03-JUL-97 X-ray diffraction resolution 2.1 A
280 73 1KIP 23-OCT-96 X-ray diffraction resolution 2.1 A complex with mAb D1.3
280 74 1KIQ 23-OCT-96 X-ray diffraction resolution 1.85 A complex with mAb D1.3
280 75 1KIR 23-OCT-96 X-ray diffraction resolution 2.0 A complex with mAb D1.3
280 76 1LSG 25-OCT-94 X-ray diffraction resolution 2.4 A res 398-411 C human fibrinogen
280 77 1MEL 06-JUN-96 X-ray diffraction resolution 2.5 A complex with Ab
280 78 1RFP 14-NOV-96 X-ray diffraction resolution 1.75 A
280 79 1UCO 31-DEC-95 X-ray diffraction resolution 2.0 A
280 80 1AKI 19-MAY-97 X-ray diffraction resolution 1.5 A
280 81 1KXW 22-NOV-96 X-ray diffraction resolution 1.96 A mutant N27D
280 82 1KXX 22-NOV-96 X-ray diffraction resolution 1.71 A mutant D18N, N27D
280 83 1KXY 22-NOV-96 X-ray diffraction resolution 1.79 A mutant D18N
280 84 1LSY 27-SEP-94 X-ray diffraction resolution 1.9 A mutant D52S
280 85 1LSZ 27-SEP-94 X-ray diffraction resolution 2.0 A mutant D52S complex with tetra-N-acetylchitotetraose
280 86 1MLC 10-MAR-95 X-ray diffraction resolution 2.1 A complex with IgG mAb
280 87 1UIA 26-NOV-96 X-ray diffraction resolution 1.76 A deleted residues (14,15)
280 88 1UIB 26-NOV-96 X-ray diffraction resolution 1.76 A deleted residues (14,15)
280 89 1UIC 26-NOV-96 X-ray diffraction resolution 1.95 A mutant H15A
280 90 1UID 26-NOV-96 X-ray diffraction resolution 1.95 A mutant H15F
280 91 1UIE 26-NOV-96 X-ray diffraction resolution 1.95 A mutant H15G
280 92 1UIF 26-NOV-96 X-ray diffraction resolution 1.85 A mutant H15V
280 93 1UIG 26-NOV-96 X-ray diffraction resolution 1.95 A
280 94 1UIH 26-NOV-96 X-ray diffraction resolution 1.75 A
280 95 1VFB 03-DEC-93 X-ray diffraction resolution 1.8 A complex with mAb D1.3
280 96 2IFF 03-FEB-94 X-ray diffraction resolution 2.65 A mutant R68K complex with IgG
280 97 1AT5 18-AUG-97 X-ray diffraction resolution 1.8 A succinimide at residue 101
280 98 1AT6 19-AUG-97 X-ray diffraction resolution 1.8 A isoaspartate at residue 101
280 99 1AZF 17-NOV-97 X-ray diffraction resolution 1.8 A
280 100 1XEI 16-JAN-98 X-ray diffraction resolution 2.1 A
280 101 1XEJ 16-JAN-98 X-ray diffraction resolution 2.1 A
280 102 1XEK 16-JAN-98 X-ray diffraction resolution 2.3 A
280 103 1A2Y 13-JAN-98 X-ray diffraction resolution 1.5 A mutant R68K, complex with mAb D1.3
280 104 1LKR 20-JAN-98 X-ray diffraction resolution 1.6 A 17 I-
280 105 1LKS 09-OCT-97 X-ray diffraction resolution 1.1 A
280 106 1LYO 05-MAR-98 X-ray diffraction resolution 1.93 A
280 107 2LYO 06-MAR-98 X-ray diffraction resolution 1.93 A
280 108 3LYO 11-MAR-98 X-ray diffraction resolution 1.93 A
280 109 4LYO 11-MAR-98 X-ray diffraction resolution 2.05 A
280 110 1LPI 15-APR-98 X-ray diffraction resolution 2.0 A
280 111 1HSW 04-JUN-98 X-ray diffraction resolution 2.0 A 88 % humidity
280 112 1HSX 04-JUN-98 X-ray diffraction resolution 1.9 A
280 113 1LCN 27-OCT-98 X-ray diffraction resolution 1.63 A 3 thiocyanate sites
280 114 1BWH 24-SEP-98 X-ray diffraction resolution 1.8 A
280 115 1BWI 24-SEP-98 X-ray diffraction resolution 1.8 A
280 116 1BWJ 18-SEP-98 X-ray diffraction resolution 1.8 A
280 117 1BVX 18-SEP-98 X-ray diffraction resolution 1.8 A
280 118 1B0D 07-NOV-98 X-ray diffraction resolution 1.84 A
280 119 1BGI 28-MAY-98 X-ray diffraction resolution 1.7 A
280 120 1BHZ 10-JUN-98 X-ray diffraction resolution 3.9 A
280 121 1B2K 26-NOV-98 X-ray diffraction resolution 1.6 A
280 122 1BVK 16-SEP-98 X-ray diffraction resolution 2.7 A complex with HULYS11
280 123 1QTK 28-JUN-99 X-ray diffraction resolution 2.03 A
280 124 1LZ8 14-MAR-99 X-ray diffraction resolution 1.53 A 8 Cl- 1 Na+
280 125 1LZ9 15-MAR-99 X-ray diffraction resolution 1.7 A Br- Na+
280 126 1C10 16-JUL-99 X-ray diffraction resolution 2.03 A
280 127 1DPW 28-DEC-99 X-ray diffraction resolution 1.64 A
280 128 1DPX 28-DEC-99 X-ray diffraction resolution 1.65 A
280 129 1DQJ 04-JAN-00 X-ray diffraction resolution 2.0 A complex with anti-lysozyme antibody hyhel-63
280 130 1E8L 27-SEP-00 NMR, 50 structures
280 131 1FLQ 15-AUG-00 X-ray diffraction resolution 1.8 A mutant
280 132 1FLU 15-AUG-00 X-ray diffraction resolution 1.78 A mutant
280 133 1FLW 15-AUG-00 X-ray diffraction resolution 1.81 A mutant
280 134 1FLY 15-AUG-00 X-ray diffraction resolution 1.83 A mutant
280 135 1FN5 21-AUG-00 X-ray diffraction resolution 1.78 A mutant
280 136 1H6M 19-JUN-01 X-ray diffraction resolution 1.64 A complex with 2-fluorochitobiosyl
280 172 1GWD 14-MAR-02 X-ray diffraction resolution 1.77 A
280 215 2YVB 2007-04-10 X-ray diffraction resolution 1.62 A Nphl p 3
280 216 2ZYP 2009-01-27 X-ray diffraction resolution 1.18 A
2ZYP.pdb


Gal d 4 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
554 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Gal d 4 - Sequence Search :
Sequence Header Sequence
Gal d 4
SDAP Sequence ID: 146
SDAP Allergen ID: 280
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 4
SDAP Sequence ID: 553
SDAP Allergen ID: 280
MNAWVAWRNSCKGTDVQAWIRGCR
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 4
SDAP Sequence ID: 554
SDAP Allergen ID: 280
MLGKNDPMCLVLVLLGLTALLGICQGGTGCYGSVSRIDTTGASCRTAKPEGLSYCGVRASRTIAERDLGSMNKYKVLIKRVGEALCIEPAVIAGIISRESHAGKILKNGWGDRGNGFGLMQVDKRYHKIEGTWNGEAHIRQGTRILIDMVKKIQRKFPRWTRDQQLKGGISAYNAGVGNVRSYERMDIGTLHDDYSNDVVARAQYFKQHGY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d 4 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Gal d 4 87.35 0.31 3ZVQ_B 95.833 24 24 1 - 24 34 - 57 0.0000000000366 51.6 Download (SI: 553)
Gal d 4 91.6 0.79 1GBS_A 81.522 184 211 28 - 211 2 - 185 0 327 Download (SI: 554)
Gal d 4 93.65 0.81 3B6L_A 100 147 147 1 - 147 1 - 147 0 300 Download (SI: 146)
Gal d 4 - Alphafold Theoretical Model Structure
Model Structure
554_relaxed_rank_1_model_2.pdb


Coverage Plddt
Gal d 4 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P00698 Click here to process the data
212279 Click here to process the data
63426 Click here to process the data
Gal d 4 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
146 280 19 145 19 145 PF00062 Lys Domain CL0037 C-type lysozyme/alpha-lactalbumin family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Gal d 4 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.