The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 662
Allergen Scientific Name Gal d vitellogenin
Allergen Species - Systematic Name Gallus domesticus
Allergen Species - Common Name chicken
Allergen Common source foods
Allergen Common name
Allergen Keywords vitellogenin
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Gal d vitellogenin - References
ID Reference
No reference found!
Gal d vitellogenin - Protein Sequences
Source Link to source
GenBank 63887
GenBank 63885
GenBank 212881
Gal d vitellogenin - Sequence Search :
Sequence Header Sequence
Gal d vitellogenin
SDAP Sequence ID: 555
SDAP Allergen ID: 662
MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEISGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIYAPEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVTRTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQVYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQLIKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPRYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLMTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLALKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQILADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRLPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTMQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNPCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAMQGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLHKLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQAKLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSSSSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLSKIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTPVLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKAVAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFMLGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASELQPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLAKNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATKTTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d vitellogenin
SDAP Sequence ID: 556
SDAP Allergen ID: 662
MRGIILALVLTLVAHVVFLSLFVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEISGLPENAYLLK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d vitellogenin
SDAP Sequence ID: 557
SDAP Allergen ID: 662
MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEISGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIYAPEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVTRTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQVYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQLIKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPRYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLMTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLALKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQILADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKSRLPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIAGQWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTMQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNPCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAMQGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLHKLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQAKLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSASSSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLSKIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTPVLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAPQAVAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFMLGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASELQPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLAKNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATKTTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gal d vitellogenin - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
63887 Click here to process the data
63885 Click here to process the data
212881 Click here to process the data
Gal d vitellogenin - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
555 662 24 592 24 592 PF01347 Vitellogenin_N Repeat CL0020 Lipoprotein amino terminal region
555 662 626 907 626 908 PF09172 Vit_open_b-sht Domain No_clan Vitellinogen, open beta-sheet
555 662 1378 1544 1378 1544 PF09175 Vit_b-sht_shell Domain No_clan Vitellinogen, beta-sheet shell
555 662 1581 1735 1581 1736 PF00094 VWD Domain No_clan von Willebrand factor type D domain
556 662 34 81 34 81 PF01347 Vitellogenin_N Repeat CL0020 Lipoprotein amino terminal region
557 662 24 594 24 594 PF01347 Vitellogenin_N Repeat CL0020 Lipoprotein amino terminal region
557 662 628 909 628 910 PF09172 Vit_open_b-sht Domain No_clan Vitellinogen, open beta-sheet
557 662 1380 1546 1380 1546 PF09175 Vit_b-sht_shell Domain No_clan Vitellinogen, beta-sheet shell
557 662 1583 1737 1583 1738 PF00094 VWD Domain No_clan von Willebrand factor type D domain
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Gal d vitellogenin - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.