The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 795
Allergen Scientific Name Gly m glycinin G2
Allergen Species - Systematic Name Glycine max
Allergen Species - Common Name soybean
Allergen Common source foods
Allergen Common name
Allergen Keywords glycinin, 11S seed storage protein
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Gly m glycinin G2 - References
ID Reference
No reference found!
Gly m glycinin G2 - Protein Sequences
Source Link to source
GenBank 295800
Gly m glycinin G2 - Sequence Search :
Sequence Header Sequence
Gly m glycinin G2
SDAP Sequence ID: 662
SDAP Allergen ID: 795
MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Gly m glycinin G2 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Gly m glycinin G2 84.45 0.82 1FXZ_A 83.438 477 485 17 - 485 1 - 476 0 786 Download (SI: 662)
Gly m glycinin G2 - Alphafold Theoretical Model Structure
Model Structure
662_relaxed_rank_1_model_3.pdb


Coverage Plddt
Gly m glycinin G2 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
295800 Click here to process the data
Gly m glycinin G2 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
662 795 33 187 33 187 PF00190 Cupin_1 Domain CL0029 Cupin
662 795 320 461 314 462 PF00190 Cupin_1 Domain CL0029 Cupin
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Gly m glycinin G2 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 3-17 KLVLSLCFLLFSGCF IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 83-97 NGPQEIYIQQGNGIF IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 91-105 QQGNGIFGMIFPGCP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 178-192 RFYLAGNQEQEFLKY IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 190-204 LKYQQQQQGGSQSQK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 255-269 VKGGLRVTAPAMRKP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 337-351 LDFPALWLLKLSAQY IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 345-359 LKLSAQYGSLRKNAM IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
9 359-373 MFVPHYTLNANSIIY IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
10 367-381 NANSIIYALNGRALV IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
11 451-465 QHTFNLKSQQARQVK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
662_relaxed_rank_1_model_3.pdb



Epitope Reference ( ID 28): R. M. Helm, G. Cockrell, C. Connaughton, H. A. Sampson, G. A. Bannon, V. Beilinson, N. C. Nielsen, and A. W. Burks A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling. Int. Arch. Allergy Immunol. 2000, 123, 213-219.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.