The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 348
Allergen Scientific Name Hev b 1
Allergen Species - Systematic Name Hevea brasiliensis
Allergen Species - Common Name rubber (latex)
Allergen Common source others
Allergen Common name
Allergen Keywords elongation factor; Rubber elongation factor protein (REF)
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Hev b 1 - References
ID Reference
Pubmed ID: 8227860
Czuppon AB, Chen Z, Rennert S, Engelke T, Meyer HE, Heber M, Baur X. The rubber elongation factor of rubber trees (Hevea brasiliensis) is the major allergen in latex. J Allergy Clin Immunol. 1993 Nov;92(5):690-7.
Pubmed ID: 1863760
Attanyaka DP, Kekwick RG, Franklin FC. Molecular cloning and nucleotide sequencing of the rubber elongation factor gene from Hevea brasiliensis. Plant Mol Biol. 1991 Jun;16(6):1079-81.
Pubmed ID: 11275264
Banerjee B, Kanitpong K, Fink JN, Zussman M, Sussman GL, Kelly KJ, Kurup VP, Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy. Mol Immunol. 2000 Aug-Sep;37(12-13):789-98.
Hev b 1 - Protein Sequences
Source Link to source
SwissProt P15252
GenBank 18839
Hev b 1 - Sequence Search :
Sequence Header Sequence
Hev b 1
SDAP Sequence ID: 150
SDAP Allergen ID: 348
AEDEDNQQGQGEGLKYLGFVQDAATYAVTTFSNVYLFAKDKSGPLQPGVDIIEGPVKNVAVPLYNRFSYIPNGALKFVDSTVVASVTIIDRSLPPIVKDASIQVVSAIRAAPEAARSLASSLPGQTKILAKVFYGEN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hev b 1
SDAP Sequence ID: 801
SDAP Allergen ID: 348
MAEDEDNQQGQGEGLKYLGFVQDAATYAVTTFSNVYLFAKDKSGPLQPGVDIIEGPVKNVAVPLYNRFSYIPNGALKFVDSTVVASVTIIDRSLPPIVKDASIQVVSAIRAAPEAARSLASSLPGQTKILAKVFYGEN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hev b 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Hev b 1 79 0.53 5IJN_D 33.962 53 137 80 - 132 625 - 676 0.96 30.4 Download (SI: 150)
Hev b 1 77.6 0.54 5IJN_D 33.962 53 138 81 - 133 625 - 676 0.98 30.4 Download (SI: 801)
Hev b 1 - Alphafold Theoretical Model Structure
Model Structure
801_relaxed_rank_1_model_1.pdb


Coverage Plddt
Hev b 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P15252 Click here to process the data
18839 Click here to process the data
Hev b 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
150 348 10 121 8 130 PF05755 REF Family No_clan Rubber elongation factor protein (REF)
801 348 11 122 9 130 PF05755 REF Family No_clan Rubber elongation factor protein (REF)
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Hev b 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 2-11 AEDEDNQQGQ IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 16-25 KYLGFVQDAA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 36-45 YLFAKDKSGP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 46-55 LQPGVDIIEG IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 61-70 AVPLYNRFSY IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 65-74 YNRFSYIPNG IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 90-99 IDRSLPPIVK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 99-108 KDASIQVVSA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
801_relaxed_rank_1_model_1.pdb



Epitope Reference ( ID 6): B. Banerjee, K. Kanitpong, J. N. Fink, M. Zussman, G. L. Sussman, K. J. Kelly, and V. P. Kurup, Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy, Mol. Immunol. 2000, 37, 789-798.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.