The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 541
Allergen Scientific Name Hor v 1
Allergen Species - Systematic Name Hordeum vulgare
Allergen Species - Common Name barley
Allergen Common source foods
Allergen Common name
Allergen Keywords cereal trypsin/alpha-amylase inhibitor
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Hor v 1 - References
ID Reference
No reference found!
Hor v 1 - Protein Sequences
Source Link to source
SwissProt P16968
GenBank 439275
GenBank 18955
GenBank 452323
GenBank 452325
GenBank 19009
GenBank 1405736
GenBank 3367714
GenBank 18869
GenBank 167077
GenBank 19039
SwissProt P34951
SwissProt P01086
Hor v 1 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
541 184 1JTB 03-DEC-96 NMR, 16 structures LIPID TRANSFER PROTEIN COMPLEXED WITH PALMITOYL COENZYME A
541 244 1BE2 1998-05-19 Solution NMR
1BE2.pdb


Hor v 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
164 GetModel Model Pic Model Pic Model Pic Model Pic Click here
595 GetModel Model Pic Model Pic Model Pic Model Pic Click here
596 GetModel Model Pic Model Pic Model Pic Model Pic Click here
597 GetModel Model Pic Model Pic Model Pic Model Pic Click here
598 GetModel Model Pic Model Pic Model Pic Model Pic Click here
599 GetModel Model Pic Model Pic Model Pic Model Pic Click here
600 GetModel Model Pic Model Pic Model Pic Model Pic Click here
601 GetModel Model Pic Model Pic Model Pic Model Pic Click here
602 GetModel Model Pic Model Pic Model Pic Model Pic Click here
604 GetModel Model Pic Model Pic Model Pic Model Pic Click here
811 GetModel Model Pic Model Pic Model Pic Model Pic Click here
812 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Hor v 1 - Sequence Search :
Sequence Header Sequence
Hor v 1
SDAP Sequence ID: 164
SDAP Allergen ID: 541
PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPRQMSSR
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 595
SDAP Allergen ID: 541
MASKSSITPLLLAAVLASVFAAATATGQYCYAGMGLPSNPLEGCREYVAQQTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQHCRCEAVRYFIGRRSHPDWSVLKDLPGCPKEPQRDFAKVLVTPGQCNVLTVHNAPYCLGLDI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 596
SDAP Allergen ID: 541
MASKSSITPLLLAAVLASVFAAAAATGQYCYAGMGLPSNPLEGCREYVAQQTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQHCRCRVRYFIGRRSHPDWRVLKDLPGCPKEPQRDFAKVLVTPGQCNVLTVHNAPYCLGLDI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 597
SDAP Allergen ID: 541
MASKSSCDLLLAAVLVSIFAAVAAVGSEDCTPWTATPITPLPSCRDYVEQQACRIETPGPPYLAKQQCCGELANIPQQCRCQALRFFMGRKSRPDQSGLMELPGCPREVQMDFVRILVTPGFCNLTTVHNTPYCLAMDEWQWNRQFCSS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 598
SDAP Allergen ID: 541
MACKSSRSLLLLATVMVSVFAAAAAAAAATDCSPGVAFPTNLLGHCRDYVLQQTCAVFTPGSKLPEWMTSAELNYPGQPYLAKLYCCQELAEIPQQCRCEALRYFMALPVPSQPVDPSTGNVGQSGLMDLPGCPREMQRDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 599
SDAP Allergen ID: 541
MAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPELQPGYGVVL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 600
SDAP Allergen ID: 541
MAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPELQPAY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 601
SDAP Allergen ID: 541
MGAMWMKSMLLVLLLCMLMVTPMTGARSDNSGPWMWCDPEMGHKVSPLTRCRALVKLECVGNRVPEDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALGVGGGPEEVFPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYWSASTDT
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 602
SDAP Allergen ID: 541
MASDHRRFVLSGAVLLSVLAVAAATLESVKDECQLGVDFPHNPLATCHTYVIKRVCGRGPSRPMLVKERCCRELAAVPDHCRCEALRILMDGVRTPEGRVVEGRLGDRRDCPREEQRAFAATLVTAAECNLSSVQAPGVRLVLLADG
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 603
SDAP Allergen ID: 541
MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 604
SDAP Allergen ID: 541
MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 811
SDAP Allergen ID: 541
TSIYTCYEGMGLPVNPLQGCRFYVAXQTCGAVPLL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1
SDAP Sequence ID: 812
SDAP Allergen ID: 541
MAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPELQPGY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Hor v 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Hor v 1 86.4 0.71 1BIP_A 58.12 117 144 24 - 140 1 - 117 5.60519e-45 144 Download (SI: 600)
Hor v 1 81.5 0.65 1BE2_A 98.889 90 134 27 - 116 1 - 90 0 188 Download (SI: 604)
Hor v 1 79.8 0.66 4CVW_C 98.246 114 147 25 - 138 1 - 114 0 229 Download (SI: 602)
Hor v 1 86.45 0.68 1BE2_A 100 91 117 27 - 117 1 - 91 0 190 Download (SI: 603)
Hor v 1 85.85 0.71 1BIP_A 58.12 117 144 24 - 140 1 - 117 7.00649e-45 144 Download (SI: 812)
Hor v 1 72.55 0.61 1BFA_A 43.571 140 171 26 - 165 7 - 125 5.88e-25 94.7 Download (SI: 598)
Hor v 1 79.9 0.69 1B1U_A 41.803 122 149 24 - 137 1 - 117 1.27e-20 82.4 Download (SI: 597)
Hor v 1 80.35 0.72 1HSS_A 45.614 114 146 17 - 129 2 - 111 6.49e-23 88.2 Download (SI: 164)
Hor v 1 86.25 0.72 1B1U_A 43.089 123 145 25 - 143 1 - 117 3.56e-28 101 Download (SI: 595)
Hor v 1 80.6 0.67 1B1U_A 42.276 123 144 25 - 142 1 - 117 7.97e-26 95.5 Download (SI: 596)
Hor v 1 85.45 0.72 1BIP_A 58.12 117 148 24 - 140 1 - 117 8.40779e-45 144 Download (SI: 599)
Hor v 1 85.75 0.52 1TMQ_B 51.613 31 35 5 - 35 5 - 35 0.00000972 39.7 Download (SI: 811)
Hor v 1 84.6 0.71 1HSS_A 49.55 111 152 31 - 139 1 - 109 3.19e-28 102 Download (SI: 601)
Hor v 1 - Alphafold Theoretical Model Structure
Model Structure
812_relaxed_rank_1_model_3.pdb


Coverage Plddt
Hor v 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P16968 Click here to process the data
439275 Click here to process the data
18955 Click here to process the data
452323 Click here to process the data
452325 Click here to process the data
19009 Click here to process the data
1405736 Click here to process the data
3367714 Click here to process the data
18869 Click here to process the data
167077 Click here to process the data
19039 Click here to process the data
P34951 Click here to process the data
P01086 Click here to process the data
Hor v 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
164 541 30 123 10 131 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
595 541 44 135 33 140 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
596 541 44 134 34 139 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
597 541 44 129 30 134 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
598 541 46 160 46 162 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
599 541 43 137 29 137 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
600 541 43 137 29 137 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
601 541 37 135 35 144 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
602 541 56 133 27 138 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
603 541 29 113 29 113 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
604 541 29 113 29 113 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
812 541 43 137 29 137 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Hor v 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.