The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 27
Allergen Scientific Name Lol p 5
Allergen Species - Systematic Name Lolium perenne
Allergen Species - Common Name rye grass
Allergen Common source grass
Allergen Common name Poales
Allergen Keywords Lol p IX, Lol p Ib; Lol p Va
Allergen IUIS (Yes=1, No=0) 1

Lol p 5 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Lol p 5.0101
2 Lol p 5.0102
Lol p 5 - References
ID Reference
Pubmed ID: 1611548
Klysner S, Welinder KG, Lowenstein H, Matthiesen F, Group V allergens in grass pollens: IV. Similarities in amino acid compositions and NH2-terminal sequences of the group V allergens from Lolium perenne, Poa pratensis and Dactylis glomerata. Clin Exp Allergy. 1992 Apr;22(4):491-7
Pubmed ID: 1671715
Singh MB, Hough T, Theerakulpisut P, Avjioglu A, Davies S, Smith PM, Taylor P, Simpson RJ, Ward LD, McCluskey J, et al. Isolation of cDNA encoding a newly identified major allergenic protein of rye-grass pollen: intracellular targeting to the amyloplast. Proc Natl Acad Sci U S A. 1991 Feb 15;88(4):1384-8.
Lol p 5 - Protein Sequences
Source Link to source
SwissProt Q40240
SwissProt Q40237
GenBank 4416516
Lol p 5 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
177 GetModel Model Pic Model Pic Model Pic Model Pic Click here
178 GetModel Model Pic Model Pic Model Pic Model Pic Click here
804 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Lol p 5 - Sequence Search :
Sequence Header Sequence
Lol p 5
SDAP Sequence ID: 177
SDAP Allergen ID: 27
MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAEAAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAEAHPRGQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Lol p 5
SDAP Sequence ID: 178
SDAP Allergen ID: 27
MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Lol p 5
SDAP Sequence ID: 804
SDAP Allergen ID: 27
MAVQKYTVALFLAVALVAGPAASYAADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAGGYKA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Lol p 5 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Lol p 5 33.95 0.28 2M64_A 53.591 181 308 91 - 270 56 - 231 2.76e-38 136 Download (SI: 177)
Lol p 5 59.6 0.47 2M64_A 67.1 231 301 50 - 270 3 - 231 0 251 Download (SI: 804)
Lol p 5 53.45 0.42 2M64_A 78.112 233 339 60 - 288 1 - 231 0 296 Download (SI: 178)
Lol p 5 - Alphafold Theoretical Model Structure
Model Structure
804_relaxed_rank_1_model_1.pdb


Coverage Plddt
Lol p 5 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q40240 Click here to process the data
Q40237 Click here to process the data
4416516 Click here to process the data
Lol p 5 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
178 27 7 48 7 50 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
178 27 44 175 42 175 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
804 27 7 157 7 157 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Lol p 5 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.