The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 452
Allergen Scientific Name Ole e 1.0101
Allergen Species - Systematic Name Olea europea
Allergen Species - Common Name olive
Allergen Common source tree
Allergen Common name Lamiales Oleaceae
Allergen Keywords N
Allergen IUIS (Yes=1, No=0) 1
Ole e 1.0101 - References
ID Reference
Pubmed ID: 15941589
González EM, Villalba M, Quiralte J, Batanero E, Roncal F, Albar JP, Rodríguez R. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen. Mol Immunol. 2006 Feb;43(6):570-8. doi: 10.1016/j.molimm.2005.04.015. Epub 2005 Jun 6. PMID: 15941589.
Ole e 1.0101 - Protein Sequences
Source Link to source
GenBank 13195753
GenBank 7429424
Ole e 1.0101 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
527 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Ole e 1.0101 - Sequence Search :
Sequence Header Sequence
Ole e 1.0101
SDAP Sequence ID: 463
SDAP Allergen ID: 452
QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNEFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVYNKLGMYPPNM
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ole e 1.0101
SDAP Sequence ID: 527
SDAP Allergen ID: 452
MKYSSFLKQAEENLVPIFSEIDAKVKENLYKVIEAFRHHRVGVQHFAGVSGYGHDDLGRDTLDGVFAQVMGAESAAVRVQFVSGTHAIACALYGILRPGDELLSAVGSPYDTLEEVIGLRGSCQGSLADFNISYRQLPLTAAGTVDWQGLETAVRPETRLVLIQRSCGYSWRPSLAIADIARIIEIVKAQNPRTLCFVDNCYGEFIETVEPTAIGVDLMAGSLIKNPGGTIVTAGGYLAGKEEWVEAGAYRLTAPGIGREGGATFDQNRLLFQGLFLAPQMVGEAMKCNHLLAHVFDQLGYPVNPAPLSPRRDVIQAIQLGSPEKLLAFCRALQGASPISSYLQPVPAAMPGYASEVVMAGGTFIDGSTSELSADGPLREPYTVFCQGGTHWTHMAIALEEILAAFEELEDGKKA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ole e 1.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ole e 1.0101 93.65 0.8 6YOA_A 86.923 130 130 1 - 130 16 - 145 0 243 Download (SI: 463)
Ole e 1.0101 95.8 0.88 3HT4_A 48.284 408 415 2 - 409 10 - 414 0 410 Download (SI: 527)
Ole e 1.0101 - Alphafold Theoretical Model Structure
Model Structure
527_relaxed_rank_1_model_1.pdb


Coverage Plddt
Ole e 1.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
13195753 Click here to process the data
7429424 Click here to process the data
Ole e 1.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
463 452 2 79 1 85 PF01190 Pollen_Ole_e_1 Family CL0287 Pollen protein Ole e 1 like
527 452 5 405 3 407 PF06838 Met_gamma_lyase Domain CL0061 Methionine gamma-lyase
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ole e 1.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 67-78 MLVERDHKNEFC IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 1-18 EDVPQPPVSQFHIQGQVY IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 23-40 RAGFITELSEFIPGASLR IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 49-66 GDVTFTEVGYTRAEGLYS IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 59-76 TRAEGLYSMLVERDHKNE IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 101-119 PSLKFILNTVNGTTRTVN IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 113-130 TTRTVNPLGFFKKEALPK IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 131-145 CAQVYNKLGMYPPNM IgG Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
527_relaxed_rank_1_model_1.pdb



Epitope Reference ( ID 36): A. Barre, H. Senecha. Nguyen, C. Granier, P. Poncet, P. Rouge, Structural Basis for the IgE-Binding Cross-Reacting Epitopic Peptides of Cup s 3, a PR-5 Thaumatin-like Protein Allergen from Common Cypress (Cupressus sempervirens) Pollen. Allergies 2023, 3, 11-24
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.