The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 63
Allergen Scientific Name Ole e 8
Allergen Species - Systematic Name Olea europea
Allergen Species - Common Name olive
Allergen Common source tree
Allergen Common name Lamiales Oleaceae
Allergen Keywords Ca2+-binding protein; PCA18/PCA23
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Ole e 8 - References
ID Reference
Pubmed ID: 10648840
Ledesma A, Villalba M, Rodriguez R, Cloning, expression and characterization of a novel four EF-hand Ca(2+)-binding protein from olive pollen with allergenic activity. FEBS Lett. 2000 Jan 21;466(1):192-6.
Pubmed ID: 11991287
Ledesma A, Villalba M, Vivanco F, Rodriguez R, Olive pollen allergen Ole e 8: identification in mature pollen and presence of Ole e 8-like proteins in different pollens. Allergy. 2002 Jan;57(1):40-3.
Ole e 8 - Protein Sequences
Source Link to source
SwissProt Q9M7R0
GenBank 6901654
Ole e 8 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
201 GetModel Model Pic Model Pic Model Pic Model Pic Click here
622 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Ole e 8 - Sequence Search :
Sequence Header Sequence
Ole e 8
SDAP Sequence ID: 201
SDAP Allergen ID: 63
MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ole e 8
SDAP Sequence ID: 622
SDAP Allergen ID: 63
MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ole e 8 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ole e 8 70.05 0.38 7JTS_t 38.365 159 171 1 - 159 1 - 151 1.13e-32 115 Download (SI: 201)
Ole e 8 69.55 0.37 7JTS_t 38.365 159 171 1 - 159 1 - 151 4.1e-33 116 Download (SI: 622)
Ole e 8 - Alphafold Theoretical Model Structure
Model Structure
622_relaxed_rank_1_model_4.pdb


Coverage Plddt
Ole e 8 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
Q9M7R0 Click here to process the data
6901654 Click here to process the data
Ole e 8 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
201 63 22 81 19 82 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
201 63 94 158 94 158 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
622 63 22 81 19 82 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
622 63 94 158 94 158 PF13499 EF-hand_7 Domain CL0220 EF-hand domain pair
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ole e 8 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.