The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 678
Allergen Scientific Name Ory s TAI
Allergen Species - Systematic Name Oryza sativa
Allergen Species - Common Name rice
Allergen Common source foods
Allergen Common name
Allergen Keywords cereal trypsin/alpha-amylase inhibitor
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Ory s TAI - References
ID Reference
No reference found!
Ory s TAI - Protein Sequences
Source Link to source
GenBank 218199
GenBank 218201
GenBank 218197
GenBank 218193
GenBank 218195
GenBank 2827316
GenBank 1398913
GenBank 1398915
GenBank 1398916
GenBank 1398918
GenBank 1304216
GenBank 1304217
GenBank 1304218
Ory s TAI - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
633 GetModel Model Pic Model Pic Model Pic Model Pic Click here
635 GetModel Model Pic Model Pic Model Pic Model Pic Click here
636 GetModel Model Pic Model Pic Model Pic Model Pic Click here
637 GetModel Model Pic Model Pic Model Pic Model Pic Click here
639 GetModel Model Pic Model Pic Model Pic Model Pic Click here
641 GetModel Model Pic Model Pic Model Pic Model Pic Click here
643 GetModel Model Pic Model Pic Model Pic Model Pic Click here
644 GetModel Model Pic Model Pic Model Pic Model Pic Click here
645 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Ory s TAI - Sequence Search :
Sequence Header Sequence
Ory s TAI
SDAP Sequence ID: 633
SDAP Allergen ID: 678
MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 634
SDAP Allergen ID: 678
MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 635
SDAP Allergen ID: 678
MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 636
SDAP Allergen ID: 678
MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 637
SDAP Allergen ID: 678
MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 638
SDAP Allergen ID: 678
MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLRVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGTWSARRRAPGVLQVDIPNGGGGVCYWLARSGY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 639
SDAP Allergen ID: 678
MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 640
SDAP Allergen ID: 678
GTRLLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 641
SDAP Allergen ID: 678
MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 642
SDAP Allergen ID: 678
MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 643
SDAP Allergen ID: 678
RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 644
SDAP Allergen ID: 678
RVVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI
SDAP Sequence ID: 645
SDAP Allergen ID: 678
FGTRFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ory s TAI - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ory s TAI 78.25 0.64 1HSS_A 39.048 105 166 41 - 145 6 - 103 8.55e-17 73.2 Download (SI: 634)
Ory s TAI 82.2 0.66 1HSS_A 45.631 103 162 39 - 141 6 - 103 1.38e-19 80.5 Download (SI: 637)
Ory s TAI 82.15 0.73 1HSS_A 39.437 71 109 18 - 88 35 - 103 0.0000000013 52.8 Download (SI: 644)
Ory s TAI 79.75 0.65 1HSS_A 40.196 102 157 40 - 141 5 - 103 0.0000000000000466 65.9 Download (SI: 641)
Ory s TAI 81.25 0.53 1HSS_A 50 56 95 39 - 94 6 - 57 0.00000000106 52.4 Download (SI: 633)
Ory s TAI 79.25 0.69 1HSS_A 39.048 105 160 34 - 138 6 - 103 1.02e-16 72.8 Download (SI: 640)
Ory s TAI 62.25 0.47 1HSS_A 38.961 77 113 22 - 98 35 - 109 0.000000000455 53.9 Download (SI: 645)
Ory s TAI 81.95 0.66 1HSS_A 42.574 101 157 41 - 141 6 - 103 1.72e-17 74.7 Download (SI: 635)
Ory s TAI 77.85 0.63 1HSS_A 39.423 104 165 41 - 144 6 - 103 4.24e-17 73.9 Download (SI: 636)
Ory s TAI 83.4 0.75 1HSS_A 34.375 96 111 1 - 96 21 - 109 0.00000000251 52 Download (SI: 643)
Ory s TAI 48.75 0.39 1HSS_A 32.231 121 157 44 - 153 3 - 119 0.000234 40 Download (SI: 638)
Ory s TAI 77.75 0.63 1HSS_A 39.655 116 160 41 - 152 5 - 115 2.43e-16 72 Download (SI: 642)
Ory s TAI 76.6 0.65 1HSS_A 38.095 105 166 41 - 145 6 - 103 6.17e-16 70.9 Download (SI: 639)
Ory s TAI - Alphafold Theoretical Model Structure
Model Structure
645_relaxed_rank_1_model_2.pdb


Coverage Plddt
Ory s TAI - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
218199 Click here to process the data
218201 Click here to process the data
218197 Click here to process the data
218193 Click here to process the data
218195 Click here to process the data
2827316 Click here to process the data
1398913 Click here to process the data
1398915 Click here to process the data
1398916 Click here to process the data
1398918 Click here to process the data
1304216 Click here to process the data
1304217 Click here to process the data
1304218 Click here to process the data
Ory s TAI - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
633 678 39 94 22 95 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
634 678 41 147 36 153 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
635 678 41 143 28 149 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
636 678 41 146 36 152 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
637 678 39 143 25 149 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
638 678 62 131 42 149 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
639 678 55 147 37 153 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
640 678 34 140 29 146 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
641 678 41 143 26 149 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
642 678 42 146 31 152 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
643 678 15 92 2 98 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
644 678 17 90 2 96 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
645 678 19 94 3 100 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ory s TAI - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.