The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 552
Allergen Scientific Name Pha a 5
Allergen Species - Systematic Name Phalaris aquatica
Allergen Species - Common Name canary grass
Allergen Common source grass
Allergen Common name Poales
Allergen Keywords Clone 28
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Pha a 5 - References
ID Reference
No reference found!
Pha a 5 - Protein Sequences
Source Link to source
SwissProt P56164
SwissProt P56165
SwissProt P56166
SwissProt P56167
Pha a 5 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
215 GetModel Model Pic Model Pic Model Pic Model Pic Click here
216 GetModel Model Pic Model Pic Model Pic Model Pic Click here
217 GetModel Model Pic Model Pic Model Pic Model Pic Click here
218 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Pha a 5 - Sequence Search :
Sequence Header Sequence
Pha a 5
SDAP Sequence ID: 215
SDAP Allergen ID: 552
MAVQKYTMALFLAVALVAGPAAPTPPTPRTPPLLPPPRARDKATLTSRSVEDINAASRRPWWASVPPADKFKTFADHVLCVPNADVTSAATKAPQLKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKPATEEVVADPVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPPLSPQPPQVLPLAAGGAATVAAASDVRVCRSHGTLQDACLLRCRGGCQPVVWRGGSHRARGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Pha a 5
SDAP Sequence ID: 216
SDAP Allergen ID: 552
MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASPQHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAIEVITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVAGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Pha a 5
SDAP Sequence ID: 217
SDAP Allergen ID: 552
MAVQKYTVALFLAMALVAGPAASYAADAGTPPTPATPAVPGAAAGKATTHEQKLIEDINAAFKWWPASAPPADKYKTFETAFSKANIAGASTKGLDAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMAGTLEVHAVKPATEEEVPSAKILRANSRSSTRSSRFKIAATVATPLSHSTAANSAPANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Pha a 5
SDAP Sequence ID: 218
SDAP Allergen ID: 552
AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Pha a 5 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Pha a 5 39.95 0.39 2M64_A 57.917 240 294 44 - 261 2 - 230 0 204 Download (SI: 217)
Pha a 5 48.05 0.41 2M64_A 61.161 224 320 44 - 255 7 - 230 0 222 Download (SI: 215)
Pha a 5 40.3 0.38 2M64_A 62.275 167 305 105 - 266 65 - 231 0 158 Download (SI: 216)
Pha a 5 49.75 0.42 2M64_A 75.177 141 175 1 - 141 93 - 230 0 173 Download (SI: 218)
Pha a 5 - Alphafold Theoretical Model Structure
Model Structure
218_relaxed_rank_1_model_3.pdb


Coverage Plddt
Pha a 5 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P56164 Click here to process the data
P56165 Click here to process the data
P56166 Click here to process the data
P56167 Click here to process the data
Pha a 5 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
215 552 7 145 7 145 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
217 552 7 86 7 92 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
217 552 94 140 87 140 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
218 552 2 28 1 28 PF01620 Pollen_allerg_2 Family No_clan Ribonuclease (pollen allergen)
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Pha a 5 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.