The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 318
Allergen Scientific Name Pru p 3
Allergen Species - Systematic Name Prunus persica
Allergen Species - Common Name peach
Allergen Common source foods
Allergen Common name
Allergen Keywords lipid transfer protein; homolog: pathogenesis related protein PR14;
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Pru p 3 - References
ID Reference
Pubmed ID: 13679821
Garcia-Casado G, Pacios LF, Diaz-Perales A, Sanchez-Monge R, Lombardero M, Garcia-Selles FJ, Polo F, Barber D, Salcedo G, Identification of IgE-binding epitopes of the major peach allergen Pru p 3. J Allergy Clin Immunol. 2003 Sep;112(3):599-605.
Pubmed ID: 14564363
Fernandez-Rivas M, Gonzalez-Mancebo E, Rodriguez-Perez R, Benito C, Sanchez-Monge R, Salcedo G, Alonso MD, Rosado A, Tejedor MA, Vila C, Casas ML, Clinically relevant peach allergy is related to peach lipid transfer protein, Pru p 3, in the Spanish population. J Allergy Clin Immunol. 2003 Oct;112(4):789-95.
Pubmed ID: 12642848
Diaz-Perales A, Sanz ML, Garcia-Casado G, Sanchez-Monge R, Garcia-Selles FJ, Lombardero M, Polo F, Gamboa PM, Barber D, Salcedo G, Recombinant Pru p 3 and natural Pru p 3, a major peach allergen, show equivalent immunologic reactivity: a new tool for the diagnosis of fruit allergy. J Allergy Clin Immunol. 2003 Mar;111(3):628-33.
Pubmed ID: 12359007
Carnes J, Fernandez-Caldas E, Gallego MT, Ferrer A, Cuesta-Herranz J, Pru p 3 (LTP) content in peach extracts. Allergy. 2002 Nov;57(11):1071-5.
Pubmed ID: 11419731
Pastorello EA, Farioli L, Pravettoni V, Giuffrida MG, Ortolani C, Fortunato D, Trambaioli C, Scibola E, Calamari AM, Robino AM, Conti A, Characterization of the major allergen of plum as a lipid transfer protein. J Chromatogr B Biomed Sci Appl. 2001 May 25;756(1-2):95-103.
Pru p 3 - Protein Sequences
Source Link to source
SwissProt P81402
GenBank 17974195
Pru p 3 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
318 223 2ALG 2005-08-05 X-ray diffraction resolution 2.30 A
318 248 2B5S 2005-09-29 X-ray diffraction resolution 2.35 A
2B5S.pdb


Pru p 3 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
243 GetModel Model Pic Model Pic Model Pic Model Pic Click here
625 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Pru p 3 - Sequence Search :
Sequence Header Sequence
Pru p 3
SDAP Sequence ID: 243
SDAP Allergen ID: 318
ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Pru p 3
SDAP Sequence ID: 625
SDAP Allergen ID: 318
ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Pru p 3 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Pru p 3 96.2 0.8 2ALG_A 100 91 91 1 - 91 2 - 92 0 177 Download (SI: 625)
Pru p 3 96.25 0.8 2ALG_A 97.802 91 91 1 - 91 2 - 92 0 175 Download (SI: 243)
Pru p 3 - Alphafold Theoretical Model Structure
Model Structure
625_relaxed_rank_1_model_3.pdb


Coverage Plddt
Pru p 3 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P81402 Click here to process the data
17974195 Click here to process the data
Pru p 3 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
243 318 3 87 3 87 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
625 318 3 87 3 87 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Pru p 3 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.