The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 1835
Allergen Scientific Name Pun g 14.0101
Allergen Species - Systematic Name Punica granatum
Allergen Species - Common Name Pomegranate
Allergen Common source food
Allergen Common name Plantae Magnoliopsida
Allergen Keywords Chitinase III
Allergen IUIS (Yes=1, No=0) 1
Pun g 14.0101 - References
ID Reference
Pubmed ID: 30241023
Tuppo L, Giangrieco I, Alessandri C, Ricciardi T, Rafaiani C, Ciancamerla M, Ferrara R, Zennaro D, Bernardi ML, Tamburrini M, Mari A, Ciardiello MA. Pomegranate chitinase III: Identification of a new allergen and analysis of sensitization patterns to chitinases. Mol Immunol. 2018 Nov;103:89-95. doi: 10.1016/j.molimm.2018.09.009. Epub 2018 Sep 19. PMID: 30241023.
Pun g 14.0101 - Protein Sequences
Source Link to source
GenBank G1UH28
Pun g 14.0101 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
1835 333 4TOQ 2014-09-10 X-ray diffraction resolution 1.6 A Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity
4TOQ.pdb


Pun g 14.0101 - Sequence Search :
Sequence Header Sequence
Pun g 14.0101
SDAP Sequence ID: 1585
SDAP Allergen ID: 1835
MAKTLPFSRALLLSLSILLVARAISAGDIAIYWGQNGGEGTLASTCDTGRYAYVIVSFVTTFGNFRAPVVNLAGHCDPAAGTCTGLSDEIRSCQGKDIKVLMSIGGGAGDYSLVSEADADNFADYLWNNFLGGQSSSRPLGDAVLDGIDFDIELGTTTFYDTLARALSSRSTQAAKVYLTAAPQCPHPDSHLDAALNTGLFDNVWIQFYNNPLAQCQYSSGNTNDILSSWNTWTSSTTAGKIFLGLPAAPEAAGSGYIPPDVLTGQILPQIKTSAKYGGVMLYSKFYDTTYSTTIKDQV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Pun g 14.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Pun g 14.0101 94 0.86 4TOQ_A 100 273 299 27 - 299 1 - 273 0 561 Download (SI: 1585)
Pun g 14.0101 - Alphafold Theoretical Model Structure
Model Structure
1585_relaxed_rank_1_model_2.pdb


Coverage Plddt
Pun g 14.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
G1UH28 Click here to process the data
Pun g 14.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1585 1835 29 254 28 288 PF00704 Glyco_hydro_18 Domain CL0058 Glycosyl hydrolases family 18
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Pun g 14.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.