The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 1846
Allergen Scientific Name Sal k 6.0101
Allergen Species - Systematic Name Salsola kali
Allergen Species - Common Name Russian-thistle
Allergen Common source Plant
Allergen Common name Plantae Magnoliopsida
Allergen Keywords Polygalacturonase
Allergen IUIS (Yes=1, No=0) 1
Sal k 6.0101 - References
ID Reference
Pubmed ID: 28502749
Mas S, Oeo-Santos C, Cuesta-Herranz J, Díaz-Perales A, Colás C, Fernández J, Barber D, Rodríguez R, de Los Ríos V, Barderas R, Villalba M. A relevant IgE-reactive 28kDa protein identified from Salsola kali pollen extract by proteomics is a natural degradation product of an integral 47kDa polygalaturonase. Biochim Biophys Acta Proteins Proteom. 2017 Aug;1865(8):1067-1076. doi: 10.1016/j.bbapap.2017.05.007. Epub 2017 May 10. PMID: 28502749.
Sal k 6.0101 - Protein Sequences
Source Link to source
GenBank ARS33724
GenBank AHL24657
Sal k 6.0101 - Sequence Search :
Sequence Header Sequence
Sal k 6.0101
SDAP Sequence ID: 1596
SDAP Allergen ID: 1846
MKTFNLPLLVALFYLFVSVARSQGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPIVTGKQNPVACGAPATPAAP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sal k 6.0101
SDAP Sequence ID: 1597
SDAP Allergen ID: 1846
QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPIVTGKQNPVACGAPATPAAP
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sal k 6.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Sal k 6.0101 93.85 0.84 4C2L_A 27.247 356 401 37 - 379 25 - 374 5.54e-25 106 Download (SI: 1596)
Sal k 6.0101 96.4 0.89 4C2L_A 28.012 332 379 37 - 356 48 - 373 2.03e-25 107 Download (SI: 1597)
Sal k 6.0101 - Alphafold Theoretical Model Structure
Model Structure
1597_relaxed_rank_1_model_1.pdb


Coverage Plddt
Sal k 6.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
ARS33724 Click here to process the data
AHL24657 Click here to process the data
Sal k 6.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1596 1846 51 380 51 392 PF00295 Glyco_hydro_28 Repeat CL0268 Glycosyl hydrolases family 28
1597 1846 29 358 29 370 PF00295 Glyco_hydro_28 Repeat CL0268 Glycosyl hydrolases family 28
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Sal k 6.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.