The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 1854
Allergen Scientific Name Sal s 7.01
Allergen Species - Systematic Name Salmo salar
Allergen Species - Common Name Atlantic salmon
Allergen Common source food
Allergen Common name Animalia Chordata
Allergen Keywords Creatine kinase
Allergen IUIS (Yes=1, No=0) 1
Sal s 7.01 - References
ID Reference
Pubmed ID: 32860256
Ruethers T, Taki AC, Karnaneedi S, Nie S, Kalic T, Dai D, Daduang S, Leeming M, Williamson NA, Breiteneder H, Mehr SS, Kamath SD, Campbell DE, Lopata AL. Expanding the allergen repertoire of salmon and catfish. Allergy. 2021 May;76(5):1443-1453. doi: 10.1111/all.14574. Epub 2020 Oct 15. PMID: 32860256.
Sal s 7.01 - Protein Sequences
Source Link to source
GenBank ACH70914
Sal s 7.01 - Sequence Search :
Sequence Header Sequence
Sal s 7.01
SDAP Sequence ID: 1604
SDAP Allergen ID: 1854
MPFGNTHNNFKLNFKVEEEYPDLTKHNNHMAKVLTKDMYAKLRDKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEIFKDLLDPIISDRHSGYKPTDKHKTDLNFENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHNSRGERRAVEKLSVEALNTLDGEFKGKYYPLNKMTDAEQEQLIADHFLFDKPVSPLLLGAGMARDWPDARGIWHNDAKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLKRIEETFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLSTHPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVDQVQMVVDGVKLMVEMEKKLEKGEAIDGMIPAQK
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sal s 7.01 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Sal s 7.01 96 0.86 1I0E_A 88.189 381 381 1 - 381 1 - 381 0 706 Download (SI: 1604)
Sal s 7.01 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
ACH70914 Click here to process the data
Sal s 7.01 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
1604 1854 25 93 24 94 PF02807 ATP-gua_PtransN Domain No_clan ATP:guanido phosphotransferase, N-terminal domain
1604 1854 154 366 153 367 PF00217 ATP-gua_Ptrans Domain CL0286 ATP:guanido phosphotransferase, C-terminal catalytic domain
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Sal s 7.01 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.