The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 320
Allergen Scientific Name Sin a 1
Allergen Species - Systematic Name Sinapis alba
Allergen Species - Common Name white mustard
Allergen Common source foods
Allergen Common name
Allergen Keywords 2S albumin
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Sin a 1 - References
ID Reference
Pubmed ID: 8647131
Gonzalez De La Pena MA, Monsalve RI, Batanero E, Villalba M, Rodriguez R, Expression in Escherichia coli of Sin a 1, the major allergen from mustard. Eur J Biochem. 1996 May 1;237(3):827-32.
Pubmed ID: 8093997
Gonzalez de la Pena MA, Villalba M, Garcia-Lopez JL, Rodriguez R, Cloning and expression of the major allergen from yellow mustard seeds, Sin a I. Biochem Biophys Res Commun. 1993 Jan 29;190(2):648-53.
Pubmed ID: 1690853
Menendez-Arias L, Dominguez J, Moneo I, Rodriguez R, Epitope mapping of the major allergen from yellow mustard seeds, Sin a I, Mol Immunol. 1990 Feb;27(2):143-50.
Pubmed ID: 3181153
Menendez-Arias L, Moneo I, Dominguez J, Rodriguez R Primary structure of the major allergen of yellow mustard (Sinapis alba L.) seed, Sin a I. Eur J Biochem. 1988 Oct 15;177(1):159-66.
Sin a 1 - Protein Sequences
Source Link to source
SwissProt P15322
GenBank 7545129
GenBank 1009442
GenBank 1009434
GenBank 1009436
GenBank 1009438
GenBank 1009440
Sin a 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
251 GetModel Model Pic Model Pic Model Pic Model Pic Click here
617 GetModel Model Pic Model Pic Model Pic Model Pic Click here
619 GetModel Model Pic Model Pic Model Pic Model Pic Click here
620 GetModel Model Pic Model Pic Model Pic Model Pic Click here
621 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Sin a 1 - Sequence Search :
Sequence Header Sequence
Sin a 1
SDAP Sequence ID: 251
SDAP Allergen ID: 320
PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHVISRIYQTATHLPKVCNIPQVSVCPFKKTMPGPS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sin a 1
SDAP Sequence ID: 616
SDAP Allergen ID: 320
PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPHLQHVISRIYQTATHLPKVCNIRQVSVCPFKKTMPGPS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sin a 1
SDAP Sequence ID: 617
SDAP Allergen ID: 320
PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQKPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTATHLPKVCNIPQVSVCPFKKTMPGPS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sin a 1
SDAP Sequence ID: 618
SDAP Allergen ID: 320
PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTATHLPRVCNIRQVSVCPFQKTMPGPS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sin a 1
SDAP Sequence ID: 619
SDAP Allergen ID: 320
PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLEGEFDFEDDMENPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTATHLPKVCNIPQVSVCPFKKTMPGPS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sin a 1
SDAP Sequence ID: 620
SDAP Allergen ID: 320
PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTATHLPKVCNIPQVSVCPFKKTMPGPS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sin a 1
SDAP Sequence ID: 621
SDAP Allergen ID: 320
PAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTATHLPKVCNIPQVSVCPFKKTMPGPS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Sin a 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Sin a 1 64.15 0.51 1SM7_A 49.612 129 145 9 - 137 4 - 106 3.6e-30 106 Download (SI: 617)
Sin a 1 65.05 0.53 1SM7_A 49.612 129 145 9 - 137 4 - 106 2.83e-30 106 Download (SI: 621)
Sin a 1 64.25 0.51 1SM7_A 49.612 129 145 9 - 137 4 - 106 2.99e-30 106 Download (SI: 619)
Sin a 1 75.15 0.62 1SM7_A 54.054 111 127 9 - 119 4 - 106 1.26e-34 117 Download (SI: 251)
Sin a 1 66.1 0.54 1SM7_A 49.612 129 145 9 - 137 4 - 106 1.07e-30 107 Download (SI: 616)
Sin a 1 65.5 0.54 1SM7_A 49.612 129 145 9 - 137 4 - 106 5.16e-30 105 Download (SI: 620)
Sin a 1 64.45 0.52 1SM7_A 49.612 129 145 9 - 137 4 - 106 1.43e-30 107 Download (SI: 618)
Sin a 1 - Alphafold Theoretical Model Structure
Model Structure
621_relaxed_rank_1_model_4.pdb


Coverage Plddt
Sin a 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P15322 Click here to process the data
7545129 Click here to process the data
1009442 Click here to process the data
1009434 Click here to process the data
1009436 Click here to process the data
1009438 Click here to process the data
1009440 Click here to process the data
Sin a 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
251 320 23 117 10 117 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
616 320 23 135 10 135 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
617 320 23 135 10 135 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
618 320 23 135 10 135 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
619 320 23 135 10 135 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
620 320 23 135 10 135 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
621 320 23 135 10 135 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Sin a 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.