The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 686
Allergen Scientific Name Tri a TAI
Allergen Species - Systematic Name Triticum aestivum
Allergen Species - Common Name wheat
Allergen Common source foods
Allergen Common name
Allergen Keywords cereal trypsin/alpha-amylase inhibitor; CM16 protein
Allergen IUIS (Yes=1, No=0) 0
ID Allergen Name
Tri a TAI - References
ID Reference
No reference found!
Tri a TAI - Protein Sequences
Source Link to source
GenBank 21916
GenBank 21713
GenBank 21920
GenBank 21701
GenBank 21711
SwissProt P01084
SwissProt P10846
SwissProt P01083
SwissProt P01085
SwissProt P16852
SwissProt P81496
Tri a TAI - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
692 GetModel Model Pic Model Pic Model Pic Model Pic Click here
693 GetModel Model Pic Model Pic Model Pic Model Pic Click here
694 GetModel Model Pic Model Pic Model Pic Model Pic Click here
695 GetModel Model Pic Model Pic Model Pic Model Pic Click here
820 GetModel Model Pic Model Pic Model Pic Model Pic Click here
821 GetModel Model Pic Model Pic Model Pic Model Pic Click here
822 GetModel Model Pic Model Pic Model Pic Model Pic Click here
823 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Tri a TAI - Sequence Search :
Sequence Header Sequence
Tri a TAI
SDAP Sequence ID: 691
SDAP Allergen ID: 686
MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGSPYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAMEESQWS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 692
SDAP Allergen ID: 686
MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 693
SDAP Allergen ID: 686
MASKSSITHLLLAAVLVSVFAAAAATGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNTPYCLGLDI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 694
SDAP Allergen ID: 686
MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNVMTVHNAPYCLGLDI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 695
SDAP Allergen ID: 686
MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQWS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 820
SDAP Allergen ID: 686
SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADISEWPRCGALYSMLDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 821
SDAP Allergen ID: 686
SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 822
SDAP Allergen ID: 686
SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAYPDV
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 823
SDAP Allergen ID: 686
SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 824
SDAP Allergen ID: 686
NEDCTPWTSTLIXPLPXCRNYVXXQAC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI
SDAP Sequence ID: 828
SDAP Allergen ID: 686
SFREQCVPGREITYECLNACAEYAVRQ
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Tri a TAI - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Tri a TAI 92.05 0.57 1HSS_A 88.636 44 44 1 - 44 1 - 44 2.48e-23 85.1 Download (SI: 821)
Tri a TAI 73.35 0.26 7CPX_A 60 15 27 1 - 15 461 - 475 6.6 23.5 Download (SI: 824)
Tri a TAI 83.2 0.68 1B1U_A 42.735 117 143 29 - 137 5 - 117 2.46e-22 86.7 Download (SI: 695)
Tri a TAI 86.1 0.82 1HSS_A 94.355 124 124 1 - 124 1 - 124 0 239 Download (SI: 820)
Tri a TAI 86.5 0.72 1B1U_A 42.276 123 145 25 - 143 1 - 117 3.57e-27 99 Download (SI: 694)
Tri a TAI 88.65 0.85 1HSS_A 100 124 124 1 - 124 1 - 124 0 254 Download (SI: 823)
Tri a TAI 82.85 0.68 1B1U_A 41.026 117 143 29 - 137 5 - 117 7.6e-21 82.8 Download (SI: 691)
Tri a TAI 75.25 0.65 1BFA_A 42.466 146 168 17 - 162 1 - 125 7.03e-23 89.4 Download (SI: 692)
Tri a TAI 85.25 0.71 1B1U_A 43.902 123 145 25 - 143 1 - 117 3.45e-28 101 Download (SI: 693)
Tri a TAI 85.95 0.82 1HSS_A 59.524 126 123 1 - 122 1 - 123 7.25004e-41 132 Download (SI: 822)
Tri a TAI - Alphafold Theoretical Model Structure
Model Structure
828_relaxed_rank_1_model_4.pdb


Coverage Plddt
Tri a TAI - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
21916 Click here to process the data
21713 Click here to process the data
21920 Click here to process the data
21701 Click here to process the data
21711 Click here to process the data
P01084 Click here to process the data
P10846 Click here to process the data
P01083 Click here to process the data
P01085 Click here to process the data
P16852 Click here to process the data
P81496 Click here to process the data
Tri a TAI - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
691 686 44 129 30 134 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
692 686 43 157 43 159 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
693 686 44 135 37 140 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
694 686 44 135 39 140 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
695 686 44 129 30 134 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
820 686 20 104 6 115 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
822 686 24 104 5 113 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
823 686 17 104 6 115 PF00234 Tryp_alpha_amyl Domain CL0482 Protease inhibitor/seed storage/LTP family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Tri a TAI - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.