![]() |
![]() |
Department of Biochemistry and Molecular Biology | Sealy Center for Structural Biology | Computational Biology |
![]() SDAP Tools About SDAP Our Software Tools Allergen Databases Protein Databases Protein Classification Bioinformatics Servers Bioinformatics Tools Bioinformatics Links |
SDAP - All Allergens
Search Results: Peptide SimilarityQuery peptide: ASNTSPASAPNALTVAAINKSNARASFSNY
Histogram for best protein-peptide similarity index Number of windows: 1646 Average PD: 13.412019 Standard deviation: 1.140225 1 0.5 1 2 1.0 0 3 1.5 0 4 2.0 0 5 2.5 3 6 3.0 0 7 3.5 0 8 4.0 0 9 4.5 0 10 5.0 0 11 5.5 1 12 6.0 0 13 6.5 2 14 7.0 1 15 7.5 1 16 8.0 4 17 8.5 3 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 2 22 11.0 4 23 11.5 12 24 12.0 48 25 12.5 111 26 13.0 238 27 13.5 356 28 14.0 465 29 14.5 255 30 15.0 100 31 15.5 21 32 16.0 9 33 16.5 2 34 17.0 5 35 17.5 0 Histogram for all protein-peptide similarity indices Number of windows: 364957 Average PD: 16.845587 Standard deviation: 1.278784 1 0.5 1 2 1.0 0 3 1.5 0 4 2.0 0 5 2.5 3 6 3.0 0 7 3.5 0 8 4.0 0 9 4.5 0 10 5.0 0 11 5.5 1 12 6.0 0 13 6.5 2 14 7.0 1 15 7.5 1 16 8.0 4 17 8.5 3 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 2 22 11.0 4 23 11.5 24 24 12.0 91 25 12.5 519 26 13.0 668 27 13.5 1562 28 14.0 3387 29 14.5 7388 30 15.0 14541 31 15.5 24606 32 16.0 37336 33 16.5 49252 34 17.0 56341 35 17.5 55556 36 18.0 46462 37 18.5 32883 38 19.0 19921 39 19.5 9438 40 20.0 3784 41 20.5 936 42 21.0 193 Query sequence: ASNTSPASAPNALTVAAINKSNARASFSNY |