![]() |
|
|
| Department of Biochemistry and Molecular Biology | Sealy Center for Structural Biology | Computational Biology |
|
SDAP Tools About SDAP Our Software Tools Allergen Databases Protein Databases Protein Classification Bioinformatics Servers Bioinformatics Tools Bioinformatics Links |
SDAP - All Allergens
Search Results: Peptide SimilarityQuery peptide: EEGQEEETTKQVQRYRARLSPGDVLVIPAG
Histogram for best protein-peptide similarity index Number of windows: 1646 Average PD: 14.210255 Standard deviation: 1.309383 1 0.5 1 2 1.0 0 3 1.5 0 4 2.0 0 5 2.5 3 6 3.0 0 7 3.5 0 8 4.0 0 9 4.5 0 10 5.0 0 11 5.5 0 12 6.0 0 13 6.5 2 14 7.0 4 15 7.5 7 16 8.0 3 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 7 22 11.0 8 23 11.5 7 24 12.0 15 25 12.5 15 26 13.0 56 27 13.5 132 28 14.0 239 29 14.5 449 30 15.0 417 31 15.5 208 32 16.0 38 33 16.5 17 34 17.0 6 35 17.5 4 36 18.0 4 37 18.5 1 38 19.0 1 Histogram for all protein-peptide similarity indices Number of windows: 364957 Average PD: 17.956853 Standard deviation: 1.396303 1 0.5 1 2 1.0 0 3 1.5 0 4 2.0 0 5 2.5 3 6 3.0 0 7 3.5 0 8 4.0 0 9 4.5 0 10 5.0 0 11 5.5 0 12 6.0 0 13 6.5 2 14 7.0 4 15 7.5 7 16 8.0 3 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 7 22 11.0 8 23 11.5 7 24 12.0 15 25 12.5 17 26 13.0 93 27 13.5 263 28 14.0 1076 29 14.5 2021 30 15.0 4025 31 15.5 8484 32 16.0 14881 33 16.5 23152 34 17.0 33966 35 17.5 44316 36 18.0 50447 37 18.5 51652 38 19.0 45946 39 19.5 35659 40 20.0 24298 41 20.5 14322 42 21.0 6755 43 21.5 2514 44 22.0 753 45 22.5 220 46 23.0 38 Query sequence: EEGQEEETTKQVQRYRARLSPGDVLVIPAG |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||