![]() |
![]() |
Department of Biochemistry and Molecular Biology | Sealy Center for Structural Biology | Computational Biology |
![]() SDAP Tools About SDAP Our Software Tools Allergen Databases Protein Databases Protein Classification Bioinformatics Servers Bioinformatics Tools Bioinformatics Links |
SDAP - All Allergens
Search Results: Peptide SimilarityQuery peptide: IFAPGQDILSAWIGSTTATNTISGTSMATP
Histogram for best protein-peptide similarity index Number of windows: 1646 Average PD: 13.855248 Standard deviation: 1.302714 1 0.5 1 2 1.0 2 3 1.5 1 4 2.0 0 5 2.5 0 6 3.0 3 7 3.5 2 8 4.0 3 9 4.5 1 10 5.0 0 11 5.5 0 12 6.0 0 13 6.5 0 14 7.0 0 15 7.5 0 16 8.0 0 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 0 22 11.0 1 23 11.5 4 24 12.0 13 25 12.5 37 26 13.0 124 27 13.5 302 28 14.0 386 29 14.5 336 30 15.0 314 31 15.5 85 32 16.0 19 33 16.5 7 34 17.0 1 35 17.5 3 36 18.0 0 37 18.5 0 Histogram for all protein-peptide similarity indices Number of windows: 364957 Average PD: 17.423457 Standard deviation: 1.335540 1 0.5 1 2 1.0 2 3 1.5 1 4 2.0 0 5 2.5 0 6 3.0 3 7 3.5 2 8 4.0 3 9 4.5 1 10 5.0 0 11 5.5 0 12 6.0 0 13 6.5 0 14 7.0 0 15 7.5 0 16 8.0 0 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 0 22 11.0 1 23 11.5 4 24 12.0 16 25 12.5 52 26 13.0 480 27 13.5 682 28 14.0 1705 29 14.5 3669 30 15.0 7914 31 15.5 14387 32 16.0 23736 33 16.5 34788 34 17.0 45158 35 17.5 52758 36 18.0 53734 37 18.5 47965 38 19.0 35590 39 19.5 22783 40 20.0 12245 41 20.5 5131 42 21.0 1624 43 21.5 427 44 22.0 82 45 22.5 12 Query sequence: IFAPGQDILSAWIGSTTATNTISGTSMATP |