Department of Biochemistry and Molecular Biology | Sealy Center for Structural Biology | Computational Biology |
SDAP Tools About SDAP Our Software Tools Allergen Databases Protein Databases Protein Classification Bioinformatics Servers Bioinformatics Tools Bioinformatics Links |
SDAP - All Allergens
Search Results: Peptide SimilarityQuery peptide: IFAPGQDILSAWIGSTTATNTISGTSMATP
Histogram for best protein-peptide similarity index Number of windows: 1645 Average PD: 13.854594 Standard deviation: 1.302839 1 0.5 1 2 1.0 2 3 1.5 1 4 2.0 0 5 2.5 0 6 3.0 3 7 3.5 2 8 4.0 3 9 4.5 1 10 5.0 0 11 5.5 0 12 6.0 0 13 6.5 0 14 7.0 0 15 7.5 0 16 8.0 0 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 0 22 11.0 1 23 11.5 4 24 12.0 13 25 12.5 37 26 13.0 124 27 13.5 302 28 14.0 386 29 14.5 336 30 15.0 313 31 15.5 85 32 16.0 19 33 16.5 7 34 17.0 1 35 17.5 3 36 18.0 0 37 18.5 0 Histogram for all protein-peptide similarity indices Number of windows: 364836 Average PD: 17.423324 Standard deviation: 1.335554 1 0.5 1 2 1.0 2 3 1.5 1 4 2.0 0 5 2.5 0 6 3.0 3 7 3.5 2 8 4.0 3 9 4.5 1 10 5.0 0 11 5.5 0 12 6.0 0 13 6.5 0 14 7.0 0 15 7.5 0 16 8.0 0 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 0 22 11.0 1 23 11.5 4 24 12.0 16 25 12.5 52 26 13.0 480 27 13.5 682 28 14.0 1705 29 14.5 3669 30 15.0 7913 31 15.5 14383 32 16.0 23735 33 16.5 34777 34 17.0 45146 35 17.5 52737 36 18.0 53712 37 18.5 47953 38 19.0 35573 39 19.5 22771 40 20.0 12243 41 20.5 5129 42 21.0 1621 43 21.5 426 44 22.0 82 45 22.5 12 Query sequence: IFAPGQDILSAWIGSTTATNTISGTSMATP |