The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Search Results: Peptide Similarity

Query peptide: SNARASFSNYGSVVDIFAPGQDILSAWIGS

NoAllergenLink to NCBI/
PIR/SwissProt
PD Sequence
Similarity
Index
z(PD,min)z(PD,all)Start
Residue
Matching regionEnd
Residue
1Asp f 13 P28296 0.00 11.3092 12.6822 309SNARASFSNYGSVVDIFAPGQDILSAWIGS338
2Asp fl protease 5702208 1.79 9.8797 11.4198 309SNNRASFSNFGKVVDVFAPGQDILSAWIGS338
3Asp o 13 2428 1.79 9.8797 11.4198 309SNNRASFSNFGKVVDVFAPGQDILSAWIGS338
4Asp v 13.0101 294441150 1.89 9.7985 11.3481 309RNARASFSNYGEVVDIFAPGEDILSAWIGG338
5Rho m 2.0101 Q32ZM1 3.64 8.3976 10.1111 227SDARAYFSNYGKCVDIFAPGLNILSTYIGS256
6Asp f 18.0101 2143219 4.76 7.5040 9.3219 340QDERAYFSNYGKCTDIFAPGLNILSTWIGS369
7Pen o 18 12005497 4.85 7.4269 9.2538 339ADERAYFSNYGKCTDIFAPGLNILSTWIGS368
8Pen ch 18 7963902 5.04 7.2812 9.1251 336ADERAYFSNYGKCTDIFAPGLNILSTWVGS365
9Cla c 9.0101 148361511 5.38 7.0034 8.8798 212SDERAYFSNYGKCNDIFAPGLNIQSTWIGS241
10Fus p 9.0101 A0A0U1Y1N5_GIBIN 5.43 6.9634 8.8445 206DDSRAYFSNYGKCTDIFAPGLNIQSTWIGS235
11Cur l 4.0101 193507493 5.45 6.9459 8.8290 341LDERAYFSNYGKCNDIFAPGLNILSTWIGS370
12Alt a 15.0101 A0A0F6N3V8_ALTAL 5.45 6.9459 8.8290 312LDERAYFSNYGKCNDIFAPGLNILSTWIGS341
13Cla h 9.0101 60116876 5.89 6.5997 8.5233 342ADERAYFSNYGKCNDIFAPGLNIQSTWIGS371
14Pen c 13.0101 4587983 6.07 6.4575 8.3977 305TDGSASFTNFGSVVDLYAPGQSITAAYPGG334
15Pen ch 13 6684758 6.07 6.4575 8.3977 305TDGSASFTNFGSVVDLYAPGQSITAAYPGG334
16Tri r 2.0101 5813790 6.52 6.0972 8.0795 320DDGKADFSNYGAVVDVYAPGKDITSLKPGG349
17Api d 1.0101 Q7M4I5 11.81 1.8604 4.3380 55SHTRLSCDCDDKFYDCLKNSSDTISSYFVG84
18Asp n 25 464385 11.92 1.7728 4.2606 428SILNKNLPDYTTTCNVSASYPQYLSFWWNY457
19Chi t 1.01 121219 11.93 1.7681 4.2565 113NNFRAGFVSYMKAHTDFAGAEAAWGATLDT142
20Api m 1 P00630 11.93 1.7671 4.2556 83SHTRLSCDCDDKFYDCLKNSADTISSYFVG112
21Api c 1.0101 12958582 12.10 1.6333 4.1375 55SHTRLSCDCDDTFYDCLKNSGDKISSYFVG84
22Amb a 6 O04004 12.15 1.5875 4.0970 21PTMFAASPTCDTVQNILAPCAGFLTGQEPS50
23Fel d 8.0101 303387468 12.19 1.5551 4.0684 38GLLGMNFLPTLQTIDFQGPLKDIFSLVLGH67
24Der p 7 P49273 12.20 1.5479 4.0620 163ANVVNHIGGLSILDPIFAVLSDVLTAIFQD192
25Chi t 1.0201 121227 12.21 1.5388 4.0540 113NNFRAGFVSYMKAHTDFAGAEAAWGATLDA142
26Cor a 11 19338630 12.26 1.5058 4.0248 385GNSRFPLAGKGNIVNEFERDAKELAFNLPS414
27Per a 13.0101 AVQ67919 12.33 1.4488 3.9745 145SNASCTTNCLAPLAKVIHDNFEIVEGLMTT174
28Asp n 14 4235093 12.33 1.4442 3.9704 119GLDRANFSDSGSYNWATSFPQPILTTAALN148
29Cuc m 1 807698 12.36 1.4196 3.9488 247NDGCSDTDILAAYDDAIADGVDIISLSVGG276
30Api m 5.0101 B2D0J4 12.37 1.4121 3.9421 464TYAYAYFSTNGSHYALYCAGPDPVFIAIVN493
31Can s 4.0101 XP_030482568.1 12.39 1.3950 3.9270 18ASARSSSSSSQRQCNIRAPAQLVCRAQKQG47
32Pun g 14.0101 CHIT_PUNGR 12.42 1.3721 3.9068 63GNFRAPVVNLAGHCDPAAGTCTGLSDEIRS92
33Gly m 6.0101 P04776 12.43 1.3657 3.9011 334YNPQAGSVTTATSLDFPALSWLRLSAEFGS363
34Gly m glycinin G1 169973 12.43 1.3657 3.9011 334YNPQAGSVTTATSLDFPALSWLRLSAEFGS363
35Pol d 3.0101 XP_015174445 12.43 1.3633 3.8990 557NTAKINDAASYSYQSYMTTNRSVIYAYIDG586
36Tri a 34.0101 253783729 12.44 1.3582 3.8945 150SNASCTTNCLAPLAKIINDNFGIIEGLMTT179
37Tri a 34.0101 KARG_PROCL 12.50 1.3111 3.8529 52DVIQSGVENLDSGVGIYAPDAEAYSLFAPL81
38gal d 6.0101 P87498 12.51 1.3064 3.8488 1088QATRNSRSSSSSASSISESSESTTSTPSSS1117
39Gal d 6.0101 VIT1_CHICK 12.51 1.3064 3.8488 1088QATRNSRSSSSSASSISESSESTTSTPSSS1117
40Asp o 21 166531 12.51 1.2997 3.8428 468SDGNVPVPMAGGLPRVLYPTEKLAGSKICS497
41Asp o 21 217823 12.51 1.2997 3.8428 468SDGNVPVPMAGGLPRVLYPTEKLAGSKICS497
42Tri a gliadin 170716 12.56 1.2620 3.8096 233QQQQQQQQQPSSQVSFQQPQQQYPSSQVSF262
43Tri a gliadin 170710 12.56 1.2620 3.8096 232QQQQQQQQQPSSQVSFQQPQQQYPSSQVSF261
44Pen m 8.0101 F8QN77_PENMO 12.56 1.2595 3.8074 229GFLVGGASLKPDIVDIINSRRSHVSELLTS258
45Bla g 4 P54962 12.57 1.2523 3.8010 39AGTSEALTQYKCWIDRFSYDDALVSKYTDS68
46Tri a 34.0101 253783729 12.59 1.2424 3.7923 143TSDVNIVSNASCTTNCLAPLAKIINDNFGI172
47Len c 1.0102 29539111 12.59 1.2400 3.7901 120LDLAIPVNNPGQLESFLLSGTQNQPSFLSG149
48Gly m 6.0301 P11828 12.61 1.2222 3.7744 320FNPQAGSITTATSLDFPALSWLKLSAQFGS349
49Gos h 3 P09802 12.61 1.2188 3.7714 71SVMRQTIEPNGLVLPSFTNAPQLLYIVQGR100
50Chi t 9 121259 12.62 1.2178 3.7706 82SGNQAAIRTLLHDLGVFHKTRGITKAQFGE111

Histogram for best protein-peptide similarity index
Number of windows: 1645
Average PD: 14.138322
Standard deviation: 1.250166
1 0.5 1
2 1.0 0
3 1.5 0
4 2.0 3
5 2.5 0
6 3.0 0
7 3.5 0
8 4.0 1
9 4.5 0
10 5.0 2
11 5.5 5
12 6.0 1
13 6.5 2
14 7.0 1
15 7.5 0
16 8.0 0
17 8.5 0
18 9.0 0
19 9.5 0
20 10.0 0
21 10.5 0
22 11.0 0
23 11.5 0
24 12.0 4
25 12.5 17
26 13.0 74
27 13.5 140
28 14.0 365
29 14.5 485
30 15.0 297
31 15.5 177
32 16.0 47
33 16.5 10
34 17.0 6
35 17.5 3
36 18.0 2
37 18.5 1
38 19.0 0

Histogram for all protein-peptide similarity indices
Number of windows: 364836
Average PD: 17.953611
Standard deviation: 1.415651
1 0.5 1
2 1.0 0
3 1.5 0
4 2.0 3
5 2.5 0
6 3.0 0
7 3.5 0
8 4.0 1
9 4.5 0
10 5.0 2
11 5.5 5
12 6.0 1
13 6.5 2
14 7.0 1
15 7.5 0
16 8.0 0
17 8.5 0
18 9.0 0
19 9.5 0
20 10.0 0
21 10.5 0
22 11.0 0
23 11.5 0
24 12.0 4
25 12.5 17
26 13.0 87
27 13.5 234
28 14.0 1015
29 14.5 2017
30 15.0 4248
31 15.5 8598
32 16.0 15495
33 16.5 24214
34 17.0 34502
35 17.5 44046
36 18.0 49473
37 18.5 50082
38 19.0 45482
39 19.5 35140
40 20.0 24338
41 20.5 13962
42 21.0 7561
43 21.5 3086
44 22.0 943
45 22.5 238
46 23.0 33
Query sequence: SNARASFSNYGSVVDIFAPGQDILSAWIGS

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Ovidiu Ivanciuc
Copyright   2001-2021  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.