Department of Biochemistry and Molecular Biology | Sealy Center for Structural Biology | Computational Biology |
SDAP Tools About SDAP Our Software Tools Allergen Databases Protein Databases Protein Classification Bioinformatics Servers Bioinformatics Tools Bioinformatics Links |
SDAP - All Allergens
Search Results: Peptide SimilarityQuery peptide: SNARASFSNYGSVVDIFAPGQDILSAWIGS
Histogram for best protein-peptide similarity index Number of windows: 1646 Average PD: 14.138708 Standard deviation: 1.249885 1 0.5 1 2 1.0 0 3 1.5 0 4 2.0 3 5 2.5 0 6 3.0 0 7 3.5 0 8 4.0 1 9 4.5 0 10 5.0 2 11 5.5 5 12 6.0 1 13 6.5 2 14 7.0 1 15 7.5 0 16 8.0 0 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 0 22 11.0 0 23 11.5 0 24 12.0 4 25 12.5 17 26 13.0 74 27 13.5 140 28 14.0 365 29 14.5 485 30 15.0 298 31 15.5 177 32 16.0 47 33 16.5 10 34 17.0 6 35 17.5 3 36 18.0 2 37 18.5 1 38 19.0 0 Histogram for all protein-peptide similarity indices Number of windows: 364957 Average PD: 17.953735 Standard deviation: 1.415654 1 0.5 1 2 1.0 0 3 1.5 0 4 2.0 3 5 2.5 0 6 3.0 0 7 3.5 0 8 4.0 1 9 4.5 0 10 5.0 2 11 5.5 5 12 6.0 1 13 6.5 2 14 7.0 1 15 7.5 0 16 8.0 0 17 8.5 0 18 9.0 0 19 9.5 0 20 10.0 0 21 10.5 0 22 11.0 0 23 11.5 0 24 12.0 4 25 12.5 17 26 13.0 87 27 13.5 234 28 14.0 1015 29 14.5 2017 30 15.0 4249 31 15.5 8601 32 16.0 15497 33 16.5 24217 34 17.0 34510 35 17.5 44057 36 18.0 49497 37 18.5 50099 38 19.0 45502 39 19.5 35146 40 20.0 24349 41 20.5 13971 42 21.0 7563 43 21.5 3089 44 22.0 943 45 22.5 239 46 23.0 33 Query sequence: SNARASFSNYGSVVDIFAPGQDILSAWIGS |