The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Bla g 6.0101

Sequence 82704032

Full FASTA alignment

Sequence name:
Query sequence:
MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
E

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Bla g 6.0101ABB89296Go!151184.21.3e-48
2Bla g 6.0201ABB89297Go!151170.71.5e-44
3Per a 6.0101Q1M0Y3Go!151168.01.0e-43
4Der f 39.0101QBF67841Go!153136.92.3e-34
5Der p 39.0101QXY82447Go!153136.43.3e-34
6Tyr p 34.0101D2DGW3Go!153135.75.4e-34
7Tyr p 24.0101ACL36923Go!153135.75.4e-34
8Bla g 6.0301ABB89298Go!154135.37.0e-34
9Hom a 6.0101P29291Go!150126.53.2e-31
10Pen m 6.0101ADV17344Go!150121.11.3e-29
11Amb a 10.0101Q2KN25Go!16067.12.5e-13
12Ole e 8Q9M7R0Go!17160.33.0e-11
13Ole e 8AAF31152Go!17159.26.4e-11
14Bos d 13.0201P85100Go!19949.09.0e-08
15Gal d 7.0101P02604Go!19247.72.1e-07
16Bos d 13.0101A0JNJ5Go!19247.13.1e-07
17Der f 26.0101AIO08852Go!16041.51.3e-05
18Pro c 5.0101J7HCX7Go!15338.41.0e-04
19Syr v 3P58171Go!8137.51.1e-04
20Phl p 7O82040Go!7836.61.9e-04
21Bet v 3P43187Go!20538.01.9e-04
22Ole e 3O81092Go!8436.42.3e-04
23Cup a 4.0101ABP87672Go!17737.42.5e-04
24Cyn d 7P94092Go!8036.22.5e-04
25Cyn d 7CAA62634Go!8236.22.5e-04
26Par j 4.0101CAP05019Go!8436.22.6e-04
27Sal k 7.0101ALE34025Go!8636.22.6e-04
28Jun o 4O64943Go!16537.03.0e-04
29Che a 3AAL92871Go!8635.73.8e-04
30Aln g 4O81701Go!8535.34.9e-04
31Bet v 4CAA73147Go!8535.06.3e-04
32Bet v 4Q39419Go!8535.06.3e-04
33Scy p 3.0101A0A514C9K9Go!15335.76.8e-04
34Bra n 2BAA09633Go!8234.21.0e-03
35Bra n 2Q39406Go!8334.21.0e-03
36Bra r 5.0101P69197Go!7932.43.4e-03
37Cro p 2.0101XP_019400389Go!11031.68.3e-03
38Art v 5.0101AY904434Go!8231.09.6e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Bla g 6.0101, Sequence: ABB89296
Sequence identity: 100.00 (151/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
Sequence 2 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
Sequence 2 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
Sequence 2 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG

Sequence 1 E
           E
Sequence 2 E



Alignment 2
Sequence 1:
Sequence 2: Allergen Bla g 6.0201, Sequence: ABB89297
Sequence identity: 92.72 (140/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           MDE-P-EQ--LLKKAFDAFDREKKGCISTEMVGTILEMLG-RLD-DML-E
Sequence 2 MDEIPAEQVVLLKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDE

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           IIAEVDADGSGELEFEEF--LASRFLVEEDAEAMQ-ELREAFRLYDKEGN
Sequence 2 IIAEVDADGSGELEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGN

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           GYITT-VLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
Sequence 2 GYITTAVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG

Sequence 1 E
           E
Sequence 2 E



Alignment 3
Sequence 1:
Sequence 2: Allergen Per a 6.0101, Sequence: Q1M0Y3
Sequence identity: 90.73 (137/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           MDELP-EQIQLLKKAFDAFDREK-G-IST-MVGTILEMLGH-LDDDML-E
Sequence 2 MDELPDEQIQLLKKAFDAFDREKNGFISTDMVGTILEMLGHPLDDDMLEE

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           IIAEVDADGSGELEF-EFV-LA-RFLVEEDAEAMQQEL-EAFRLYDKEGN
Sequence 2 IIAEVDADGSGELEFQEFVTLAARFLVEEDAEAMQQELKEAFRLYDKEGN

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           GYITT-VLREILKELDDK-T-EDLD-MIEEIDSDGSGTVDFDEFMEVMTG
Sequence 2 GYITTTVLREILKELDDKLTNEDLDAMIEEIDSDGSGTVDFDEFMEVMTG

Sequence 1 E
           E
Sequence 2 E



Alignment 4
Sequence 1:
Sequence 2: Allergen Der f 39.0101, Sequence: QBF67841
Sequence identity: 69.54 (105/151)
Sequence 1 --MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDML
           ----EL--EQ-Q-L-KAFD-FDREKKG-I-T-MV-TIL--LG-------L
Sequence 2 MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDL

Sequence 1 QEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKE
           Q--I-E-DADGSGELEF-EF--L--RFLVEEDAEAMQ-ELREAFR-YDKE
Sequence 2 QQLITEIDADGSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKE

Sequence 1 GNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVM
           GNGYI-T--LREIL--LDDK-T---LD-MI-EID-DGSGTVDFDEFME-M
Sequence 2 GNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 TGE
           TG-
Sequence 2 TGD



Alignment 5
Sequence 1:
Sequence 2: Allergen Der p 39.0101, Sequence: QXY82447
Sequence identity: 69.54 (105/151)
Sequence 1 --MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDML
           ----EL--EQ-Q-L-KAFD-FDREKKG-I-T-MV-TIL--LG-------L
Sequence 2 MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDL

Sequence 1 QEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKE
           Q--I-E-DADGSGELEF-EF--L--RFLVEEDAEAMQ-ELREAFR-YDKE
Sequence 2 QTLITEIDADGSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKE

Sequence 1 GNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVM
           GNGYI-T--LREIL--LDDK-T---LD-MI-EID-DGSGTVDFDEFME-M
Sequence 2 GNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 TGE
           TG-
Sequence 2 TGD



Alignment 6
Sequence 1:
Sequence 2: Allergen Tyr p 34.0101, Sequence: D2DGW3
Sequence identity: 68.21 (103/151)
Sequence 1 --MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDML
           ----EL--EQ-Q-L-KAFD-FDR-KKG-I-T-MV-TIL--LG-------L
Sequence 2 MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDL

Sequence 1 QEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKE
           Q--I-E-DADGSGELEF-EF--L--RFLVEED-EAMQ-ELREAFR-YDKE
Sequence 2 QQLIIEIDADGSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKE

Sequence 1 GNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVM
           GNGYI-T--LREIL--LDDK-T---LD-MI-EID-DGSGTVDFDEFME-M
Sequence 2 GNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 TGE
           TG-
Sequence 2 TGD



Alignment 7
Sequence 1:
Sequence 2: Allergen Tyr p 24.0101, Sequence: ACL36923
Sequence identity: 68.21 (103/151)
Sequence 1 --MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDML
           ----EL--EQ-Q-L-KAFD-FDR-KKG-I-T-MV-TIL--LG-------L
Sequence 2 MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDL

Sequence 1 QEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKE
           Q--I-E-DADGSGELEF-EF--L--RFLVEED-EAMQ-ELREAFR-YDKE
Sequence 2 QQLIIEIDADGSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKE

Sequence 1 GNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVM
           GNGYI-T--LREIL--LDDK-T---LD-MI-EID-DGSGTVDFDEFME-M
Sequence 2 GNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 TGE
           TG-
Sequence 2 TGD



Alignment 8
Sequence 1:
Sequence 2: Allergen Bla g 6.0301, Sequence: ABB89298
Sequence identity: 68.21 (103/151)
Sequence 1 ----MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDD
           -------LPPEQI--L-KAFDAFDREK-G-IST-MV--IL---G------
Sequence 2 MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRR

Sequence 1 MLQEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYD
           -L-E-I-EVDAD-SG-LEF-EFV-LA--F--EED-EAM--ELREAFRLYD
Sequence 2 TLEELIDEVDADKSGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYD

Sequence 1 KEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFME
           KEGNGYI-T--LREIL-ELD---T---LDMMIEEID-DGSGTVDFDEFME
Sequence 2 KEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEFME

Sequence 1 VMTGE
           -MTG-
Sequence 2 MMTG-



Alignment 9
Sequence 1:
Sequence 2: Allergen Hom a 6.0101, Sequence: P29291
Sequence identity: 62.25 (94/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           MD-L--EQ---L-KAFD-FD---KG-I--E-VG-IL-M-G-------LQE
Sequence 2 MDSLDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQE

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           -I-E-D-DGSGELEFEEFV-LA--FL-EED-EA---ELREAFR-YD--GN
Sequence 2 VISETDEDGSGELEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGN

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           GYITT-VL-EIL-ELD---T-EDLD--IEE-D-DGSGT-DF-EFM--M-G
Sequence 2 GYITTDVLKEILRELDNRLTEEDLDSIIEEVDEDGSGTLDFNEFMQMMNG

Sequence 1 E
           -
Sequence 2 -



Alignment 10
Sequence 1:
Sequence 2: Allergen Pen m 6.0101, Sequence: ADV17344
Sequence identity: 60.93 (92/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           MD-L--EQI--L-KAF--FD-E--G-I--E-VG-IL-M-G-------LQE
Sequence 2 MDSLDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQE

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           -IAE-D-DGSG-LEFEEF--LA--FL-EED-EA---ELREAFR-YDK---
Sequence 2 VIAETDEDGSGMLEFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQ

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           GYITT--L-EIL-ELD-K-T--DL---IEE-D-DGSGT-DFDEFME-M-G
Sequence 2 GYITTDILKEILVELDPKLTPTDLEGIIEEVDEDGSGTLDFDEFMEMMSG

Sequence 1 E
           -
Sequence 2 -



Alignment 11
Sequence 1:
Sequence 2: Allergen Amb a 10.0101, Sequence: Q2KN25
Sequence identity: 33.77 (51/151)
Sequence 1 ------MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLD
           -----------P-------K-F--FD----G-IS------IL--LG----
Sequence 2 MAPENNKHSIFPTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTS

Sequence 1 DDMLQEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRL
           -D------AE-DADG-G-----EF---------E---------L-EAF--
Sequence 2 PDEVKRVMAEIDADGDGFISLDEFILFCKG--IESEGDEIN-DLKEAFKF

Sequence 1 YDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEF
           YD---NG-I--N-L--IL--L------E----MI---DSDG-G-VDF-EF
Sequence 2 YDQNNNGVISANELHQILGRLGENYSVESCADMIKSVDSDGDGFVDFEEF

Sequence 1 MEVMTGE------
           ---M---------
Sequence 2 RKMMSRKGGDGAM



Alignment 12
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: Q9M7R0
Sequence identity: 31.13 (47/151)
Sequence 1 ------------MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEM
           -----------------P---Q-----F--FD----G-IS-------L--
Sequence 2 MAANTDRNSKPSVYLQEPNEVQ---GVFNRFDANGDGKISGDELAGVLKA

Sequence 1 LGHRLDDDMLQEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQEL
           LG----------I--E-D-D--G-----EF------------------EL
Sequence 2 LGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENEL

Sequence 1 REAFRLYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGT
           -EAF-LYD---NG-I----L--IL--L-------D---MI---DSDG-G-
Sequence 2 KEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGY

Sequence 1 VDFDEFMEVMTGE-----------
           V-F-EF---MT-------------
Sequence 2 VSFEEFKKMMTNKSGNNSQAEPPK



Alignment 13
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: AAF31152
Sequence identity: 30.46 (46/151)
Sequence 1 ------------MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEM
           -----------------P---Q-----F--FD----G-IS-------L--
Sequence 2 MAANTDRNSKPSVYLQEPNEVQ---GVFNRFDANGDGKISGDELACALKA

Sequence 1 LGHRLDDDMLQEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQEL
           LG-------------E-D-D--G-----EF------------------EL
Sequence 2 LGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENEL

Sequence 1 REAFRLYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGT
           -EAF-LYD---NG-I----L--IL--L-------D---MI---DSDG-G-
Sequence 2 KEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGY

Sequence 1 VDFDEFMEVMTGE-----------
           V-F-EF---MT-------------
Sequence 2 VSFEEFKKMMTNKSGNNSQAEPPK



Alignment 14
Sequence 1:
Sequence 2: Allergen Bos d 13.0201, Sequence: P85100
Sequence identity: 27.15 (41/151)
Sequence 1 ----------------------------------------------MDEL
           ------------------------------------------------E-
Sequence 2 MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEF

Sequence 1 PPEQIQLLKKAFDAFDREKKGC---ISTEMVGTILEMLGHRLDDDMLQEI
           -PEQI---K-AF--FDR--K-C---I-----G--L--LG-----------
Sequence 2 TPEQIEEFKEAFTLFDRTPK-CEMKITYGQCGDVLRALGQNPTQAEVLRV

Sequence 1 IAEVDAD--GSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEG
           ----------S----F--F-----------D---------E--R--DKEG
Sequence 2 LGKPKQEELNSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEG

Sequence 1 NGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFME-VM
           NG------LR--L--L--K-T-------------D--G------F----M
Sequence 2 NGTVMGAELRHVLATLGEKLTEDEVEKLMAGQE-DSNGCINYEAFVKHIM

Sequence 1 TGE
           -G-
Sequence 2 AG-



Alignment 15
Sequence 1:
Sequence 2: Allergen Gal d 7.0101, Sequence: P02604
Sequence identity: 26.49 (40/151)
Sequence 1 -----------------------------------------MDELPPEQI
           -------------------------------------------E---EQ-
Sequence 2 MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQ

Sequence 1 QLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDAD-
           ---K-AF--FDR-----I----VG-I---LG----------I--------
Sequence 2 DDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEE

Sequence 1 -GSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNV
           -------FEEF-----------D---------E--R--DKEGNG------
Sequence 2 MNAKKITFEEFLPMLQAAANNKD-QGTFEDFVEGLRVFDKEGNGTVMGAE

Sequence 1 LREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFME-VMTGE
           LR--L--L--K-T-E-----------D--G------F----M---
Sequence 2 LRHVLATLGEKMTEEEVEELMKGQE-DSNGCINYEAFVKHIMSV-



Alignment 16
Sequence 1:
Sequence 2: Allergen Bos d 13.0101, Sequence: A0JNJ5
Sequence identity: 24.50 (37/151)
Sequence 1 -----------------------------------------MDELPPEQI
           -------------------------------------------E----Q-
Sequence 2 MAPKKDVKKPAAAAAPAPAPAPAPAPAPAPPKEEKIDLSAIKIEFSKQQQ

Sequence 1 QLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDAD-
           ---K-AF--FDR-----I----VG--L--LG-------------------
Sequence 2 DEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEE

Sequence 1 -GSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNV
           ------EFE-F-----------D---------E--R--DKEGNG------
Sequence 2 MNAKKIEFEQFLPMLQAISNNKD-QGTYEDFVEGLRVFDKEGNGTVMGAE

Sequence 1 LREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFME-VMTGE
           LR--L--L--K---E-----------D--G------F----M---
Sequence 2 LRHVLATLGEKMKEEEVEALMAGQE-DSNGCINYEAFVKHIMSN-



Alignment 17
Sequence 1:
Sequence 2: Allergen Der f 26.0101, Sequence: AIO08852
Sequence identity: 25.83 (39/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           M--L-P---------FD--D------------G--L--L--R---D----
Sequence 2 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           ---E----G-----FEEF----S------D--A----L-E----YDK--N
Sequence 2 NGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAEN

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDS--DGSGTVDFDEFME-V
           G------L---L--L--K-T-------I-------D--G------F---V
Sequence 2 GTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNV

Sequence 1 MTGE--------
           M-G---------
Sequence 2 MAGPFPEEAGKS



Alignment 18
Sequence 1:
Sequence 2: Allergen Pro c 5.0101, Sequence: J7HCX7
Sequence identity: 24.50 (37/151)
Sequence 1 -MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQ
           ----L--------K-AF---D-E--G-------G--L--L--------L-
Sequence 2 MAADLSARDVERVKFAFSIYDFEGNGTMDAFYIGDCLRALN-------LN

Sequence 1 EIIAEVDADGSGE------LEFEEFVSLASRFLVEEDAEAMQQELREAFR
           ---A-----G--E---------EEF-----------DA--------E---
Sequence 2 PTLAIIEKVGGKEKRKEKIIKLEEFIPIFAQVKKDKDAGSYE-DFMEVLK

Sequence 1 LYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEI--DSDGSGTVDF
           LYDK--NG------L--IL--L--------L-----E-----D--G----
Sequence 2 LYDKSENGTMMYAELEHILLSLGERLEKSELEPVLKECCNEEDEDGFIPY

Sequence 1 DEFMEVMTGE-
           --F---MT---
Sequence 2 EPFLKKMTQLL



Alignment 19
Sequence 1:
Sequence 2: Allergen Syr v 3, Sequence: P58171
Sequence identity: 15.89 (24/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           ------------------------------------EL---F---D--G-
Sequence 2 ------------------------------MAEEVAELERIFKRFDANGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L-E-LK-L----T-E----M--EID-DG-G---F-EF------
Sequence 2 GKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFARA

Sequence 1 E-----------
           ------------
Sequence 2 NSGLIKDVAKIF



Alignment 20
Sequence 1:
Sequence 2: Allergen Phl p 7, Sequence: O82040
Sequence identity: 13.91 (21/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           ---------------------------------M-------F---D--G-
Sequence 2 ---------------------------------MADDMERIFKRFDTNGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L---L--L-----A-----M--EID-DG-G--DF-EF------
Sequence 2 GKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNEFISFCNA

Sequence 1 E-----------
           ------------
Sequence 2 NPGLMKDVAKVF



Alignment 21
Sequence 1:
Sequence 2: Allergen Bet v 3, Sequence: P43187
Sequence identity: 29.14 (44/151)
Sequence 1 -----------------------------MDELPPEQIQLLKKAFDAFDR
           ----------------------------------------L---FD-FD-
Sequence 2 MPCSTEAMEKAGHGHASTPRKRSLSNSSFRLRSESLNTLRLRRIFDLFDK

Sequence 1 EKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGELEFEEFVSL
           ---G-I--------L--LG---D---L----------G---L-FE-F-SL
Sequence 2 NSDGIITVDELSRALNLLGLETDLSELESTVKSFTREGNIGLQFEDFISL

Sequence 1 A-----SRFLVE-EDAEAMQQELREA------------FRLYDKEGNGYI
           ------S-F----ED--------R--------------F---D--G-GYI
Sequence 2 HQSLNDSYFAYGGEDEDDNEEDMRKSILSQEEADSFGGFKVFDEDGDGYI

Sequence 1 TTNVLREILKEL--DDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTGE
           ----L---L--L-------------MI---DS---G-VDF-EF---M---
Sequence 2 SARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEFKDMMRSV

Sequence 1 -----
           -----
Sequence 2 LVRSS



Alignment 22
Sequence 1:
Sequence 2: Allergen Ole e 3, Sequence: O81092
Sequence identity: 15.89 (24/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           -------------------------------E----E----F---D--G-
Sequence 2 -------------------------MADDPQEVAEHE--RIFKRFDANGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L-E-LK-L----T-E----M--EID-DG-G---F-EF------
Sequence 2 GKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFTVFARA

Sequence 1 E-----------
           ------------
Sequence 2 NRGLVKDVAKIF



Alignment 23
Sequence 1:
Sequence 2: Allergen Cup a 4.0101, Sequence: ABP87672
Sequence identity: 27.81 (42/151)
Sequence 1 ---------------------------MDELPPEQIQLLKKAFDAFDREK
           --------------------------------------L---F--FD---
Sequence 2 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG

Sequence 1 KGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGELEFEEFVSLAS
           -G-IS------IL---G---D---------E-D-DG-G-----EFV-L--
Sequence 2 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI

Sequence 1 RFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKITAED
           ---------A----L--AF---D---NG-I----L---LK------T-E-
Sequence 2 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE

Sequence 1 LDMMIEEIDSDGSGTVDFDEFMEVMTGE------
           ----I---D--G-G-----EF---MT-E------
Sequence 2 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK



Alignment 24
Sequence 1:
Sequence 2: Allergen Cyn d 7, Sequence: P94092
Sequence identity: 14.57 (22/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           --------------------------------A--------F---D--G-
Sequence 2 -------------------------------MADTGDMEHIFKRFDTNGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L---L--L-----A-----M--EID-DG-G--DFDEF------
Sequence 2 GKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFISFCNA

Sequence 1 E-----------
           ------------
Sequence 2 NPGLMKDVAKVF



Alignment 25
Sequence 1:
Sequence 2: Allergen Cyn d 7, Sequence: CAA62634
Sequence identity: 14.57 (22/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           --------------------------------A--------F---D--G-
Sequence 2 -----------------------------KTMADTGDMEHIFKRFDTNGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L---L--L-----A-----M--EID-DG-G--DFDEF------
Sequence 2 GKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFISFCNA

Sequence 1 E-----------
           ------------
Sequence 2 NPGLMKDVAKVF



Alignment 26
Sequence 1:
Sequence 2: Allergen Par j 4.0101, Sequence: CAP05019
Sequence identity: 15.23 (23/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           -----------------------------D------E----F---D--G-
Sequence 2 ---------------------------MADKQIDRAEQERIFKRFDSNGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L-E-LK-L----TA-----M--EID-DG-G-----EF------
Sequence 2 GKISSSELGEALKALGS-VTADEVHRMMAEIDTDGDGAISLEEFSSFADA

Sequence 1 E-----------
           ------------
Sequence 2 NRGLIKDIAKIF



Alignment 27
Sequence 1:
Sequence 2: Allergen Sal k 7.0101, Sequence: ALE34025
Sequence identity: 17.88 (27/151)
Sequence 1 -MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQ
           ---E--P---------F--FD----G-IS----G--L--LG----D----
Sequence 2 MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVR

Sequence 1 EIIAEVDADGSGELEFEEFVSL--ASRFLVEEDAEAMQQELREAFRLYDK
           ---AE-D-DG-G---FEEF-----A-R-L----A----------------
Sequence 2 -MMAEIDTDGDGFISFEEFTEFARANRGLIKDVAKIF-------------

Sequence 1 EGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 MTGE
           ----
Sequence 2 ----



Alignment 28
Sequence 1:
Sequence 2: Allergen Jun o 4, Sequence: O64943
Sequence identity: 27.81 (42/151)
Sequence 1 ---------------MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTI
           --------------------------L---F--FD----G-IS------I
Sequence 2 MDEVPSSDGSKSACSGEVVMEQSVHELEEVFKKFDANGDGKISGSELADI

Sequence 1 LEMLGHRLDDDMLQEIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQ
           L--LG-------------E-DADG-G-----EFV-L-----------A--
Sequence 2 LRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVDLNNK-------GASV

Sequence 1 QELREAFRLYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDG
           --L--AF---D---NG-I----L---L-------T-E-----I---D--G
Sequence 2 KDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEESKNIIHNVDKNG

Sequence 1 SGTVDFDEFMEVMTGE------
           -G-----EF---MT-E------
Sequence 2 DGLISVEEFQTMMTSEMTDKSK



Alignment 29
Sequence 1:
Sequence 2: Allergen Che a 3, Sequence: AAL92871
Sequence identity: 17.22 (26/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQEL--RE-AFRLYDK
           ------------------------------AE---Q----RE--F---D-
Sequence 2 ----------------------------MAAEDTPQDIADRERIFKRFDT

Sequence 1 EGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEV
           -G-G-I----L---LK-L----T------M--EID-DG-G---FDEF---
Sequence 2 NGDGKISSSELGDALKTLGS-VTPDEVRRMMAEIDTDGDGFISFDEFTDF

Sequence 1 MTGE-----------
           ---------------
Sequence 2 ARANRGLVKDVSKIF



Alignment 30
Sequence 1:
Sequence 2: Allergen Aln g 4, Sequence: O81701
Sequence identity: 18.54 (28/151)
Sequence 1 -MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQ
           --D--P--Q-------F--FD----G-IS----G--L--LG----D----
Sequence 2 MADDHPQDQAEH-ERIFKCFDANGDGKISASELGDALKTLGSVTPDEV-K

Sequence 1 EIIAEVDADGSGELEFEEFVSL--ASRFLVEEDAEAMQQELREAFRLYDK
           ---AE-D-DG-G---F-EF-----A-R-LV---A----------------
Sequence 2 HMMAEIDTDGDGFISFQEFTNFARANRGLVKDVAKIF-------------

Sequence 1 EGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 MTGE
           ----
Sequence 2 ----



Alignment 31
Sequence 1:
Sequence 2: Allergen Bet v 4, Sequence: CAA73147
Sequence identity: 15.89 (24/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           -----------------------------D------E----F---D--G-
Sequence 2 --------------------------MADDHPQDKAERERIFKRFDANGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L-E-LK-L---IT------M--EID-DG-G---F-EF------
Sequence 2 GKISAAELGEALKTLGS-ITPDEVKHMMAEIDTDGDGFISFQEFTDFARA

Sequence 1 E-----------
           ------------
Sequence 2 NRGLLKDVAKIF



Alignment 32
Sequence 1:
Sequence 2: Allergen Bet v 4, Sequence: Q39419
Sequence identity: 15.89 (24/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           -----------------------------D------E----F---D--G-
Sequence 2 --------------------------MADDHPQDKAERERIFKRFDANGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L-E-LK-L---IT------M--EID-DG-G---F-EF------
Sequence 2 GKISAAELGEALKTLGS-ITPDEVKHMMAEIDTDGDGFISFQEFTDFGRA

Sequence 1 E-----------
           ------------
Sequence 2 NRGLLKDVAKIF



Alignment 33
Sequence 1:
Sequence 2: Allergen Scy p 3.0101, Sequence: A0A514C9K9
Sequence identity: 21.19 (32/151)
Sequence 1 -MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQ
           ----L--------K-AF---D-E-KG------VG--L--L----------
Sequence 2 MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIE

Sequence 1 EIIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEG
           -------------L----F-----------DA--------E---LYDK--
Sequence 2 KVGGKTKKKEK-MLKVDDFLPIFAQVKKDKDAGSFE-DFMEVLKLYDKTE

Sequence 1 NGYITTNVLREILKELDDKITAEDLDMMIEEI--DSDGSGTVDFDEFMEV
           NG------L--IL--L--------L-----------D--G------F---
Sequence 2 NGTMLYAELEHILLSLGERLEKSELEPVLKDCCDEEDEDGFIPYEPFLKK

Sequence 1 MTGE-
           -T---
Sequence 2 LTQLL



Alignment 34
Sequence 1:
Sequence 2: Allergen Bra n 2, Sequence: BAA09633
Sequence identity: 15.23 (23/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQ-ELREAFRLYDKEG
           ------------------------------A-A----E----F---D--G
Sequence 2 ------------------------------ADATEKAEHDRIFKKFDANG

Sequence 1 NGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMT
           -G-I----L---LK-L----T--D---M--EID-DG-G-----EF-----
Sequence 2 DGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQEFSDFAS

Sequence 1 GE-----------
           -------------
Sequence 2 ANRGLMKDVAKIF



Alignment 35
Sequence 1:
Sequence 2: Allergen Bra n 2, Sequence: Q39406
Sequence identity: 15.23 (23/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQ-ELREAFRLYDKEG
           ------------------------------A-A----E----F---D--G
Sequence 2 -----------------------------MADATEKAEHDRIFKKFDANG

Sequence 1 NGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMT
           -G-I----L---LK-L----T--D---M--EID-DG-G-----EF-----
Sequence 2 DGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQEFSDFAS

Sequence 1 GE-----------
           -------------
Sequence 2 ANRGLMKDVAKIF



Alignment 36
Sequence 1:
Sequence 2: Allergen Bra r 5.0101, Sequence: P69197
Sequence identity: 15.23 (23/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           ------------------------------------E----F---D--G-
Sequence 2 --------------------------------MADAEHERIFKKFDTDGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L-E-LK-L----T--D---M---ID-DG-G---F-EF-E----
Sequence 2 GKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTEFASA

Sequence 1 E-----------
           ------------
Sequence 2 NPGLMKDVAKVF



Alignment 37
Sequence 1:
Sequence 2: Allergen Cro p 2.0101, Sequence: XP_019400389
Sequence identity: 19.87 (30/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           -------------------------------------M------DD----
Sequence 2 -----------------------------------MAMTDLLSADDIKKA

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           --A---A-------F-E-V-L-------------Q------F---DK---
Sequence 2 VGAFAAAESFNHKKFFEMVGLKKK---------SQDDVKKVFHILDKDRS

Sequence 1 GYITTNVLREILK-------ELDDKITAEDLDMMIEEIDSDGSGTVDFDE
           G-I----L---LK--------L-DK-T-E---------D-DG-G----DE
Sequence 2 GFIEEDELKSVLKGFTPDARDLSDKETKE----LLAAGDKDGDGKIGVDE

Sequence 1 FMEVMTGE
           F-------
Sequence 2 FTSLVAES



Alignment 38
Sequence 1:
Sequence 2: Allergen Art v 5.0101, Sequence: AY904434
Sequence identity: 15.23 (23/151)
Sequence 1 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN
           ------------------------------A-----E----F---DK-G-
Sequence 2 -----------------------------MADEDKAECDRIFGAFDKNGD

Sequence 1 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG
           G-I----L-E-L--L------E----M--E-D-DG-G----DEF-E----
Sequence 2 GKISAAELGESLTKLGS-VSPEEVQTMMDELDTDGDGYISYDEFAEFFNA

Sequence 1 E-----------
           ------------
Sequence 2 NRGLMKDVGKIF


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.