The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Sol s 3.0101

Sequence

Full FASTA alignment

Sequence name:
Query sequence:
TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Sol s 3.0101ABC58726Go!90156.88.6e-41
2Sol r 3P35779Go!211156.03.5e-40
3Sol i 3P35778Go!234156.03.8e-40
4Pac c 3.0101C0ITL3Go!19983.81.7e-18
5Ves vi 5P35787Go!20671.01.3e-14
6Pol f 5P35780Go!20570.02.5e-14
7Poly p 5.0101C0HJV9Go!20670.02.5e-14
8Vesp v 5.0101P0DMB9Go!20269.83.0e-14
9Vesp m 5P81657Go!20268.66.8e-14
10Ves g 5P35784Go!20468.48.0e-14
11Dol m 5.02AAA28302Go!21268.48.2e-14
12Dol m 5.02P10737Go!21568.48.3e-14
13Ves m 5P35760Go!20468.19.5e-14
14Ves f 5P35783Go!20467.41.6e-13
15Pol d 5P81656Go!20667.41.6e-13
16Poly s 5.0101Q7Z156Go!20767.41.6e-13
17Ves v 5Q05110Go!22767.41.7e-13
18Vesp c 5P35782Go!20267.21.8e-13
19Vesp c 5P35781Go!20267.21.8e-13
20Ves p 5P35785Go!20467.21.8e-13
21Ves s 5P35786Go!20567.21.8e-13
22Dol a 5Q05108Go!20366.72.5e-13
23Dol m 5.0101P10736Go!22766.33.8e-13
24Pol e 5.0101P35759Go!20565.74.9e-13
25Pol g 5P83377Go!20665.75.0e-13
26Pol a 5Q05109Go!20965.75.0e-13
27Poly p 5.0102P86686Go!20765.55.9e-13
28Pol e 5.0101AAT95009Go!22665.56.2e-13
29Cte f 2AAF65314Go!26449.93.7e-08
30Sco m 5.0101QEA69430Go!21035.08.8e-04
31Tab y 5.0101ADM18345Go!25633.53.2e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Sol s 3.0101, Sequence: ABC58726
Sequence identity: 100.00 (90/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
Sequence 2 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ
           NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ
Sequence 2 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ



Alignment 2
Sequence 1:
Sequence 2: Allergen Sol r 3, Sequence: P35779
Sequence identity: 98.89 (89/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
Sequence 2 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ----------
           NELRQRVASGKEMRGTN-PQPPAVKMPNLTWDPELATIAQ----------
Sequence 2 NELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DACRNVERFAVGQNIAATSSSGKNKSTLSDMILLWYNEVKDFDNRWISSF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PSDGNILMHVGHYTQIVWAKTKKIGCGRIMFKEDNWNKHYLVCNYGPAGN

Sequence 1 -----------
           -----------
Sequence 2 VLGAQIYEIKK



Alignment 3
Sequence 1:
Sequence 2: Allergen Sol i 3, Sequence: P35778
Sequence identity: 98.89 (89/90)
Sequence 1 ----------------------TNYCNLQSCKRNNAIHTMCQYTSPTPGP
           ----------------------TNYCNLQSCKRNNAIHTMCQYTSPTPGP
Sequence 2 MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGP

Sequence 1 MCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNSPQPPAVKMPN
           MCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTN-PQPPAVKMPN
Sequence 2 MCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPN

Sequence 1 LTWDPELATIAQ--------------------------------------
           LTWDPELATIAQ--------------------------------------
Sequence 2 LTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGR

Sequence 1 ----------------------------------
           ----------------------------------
Sequence 2 IMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK



Alignment 4
Sequence 1:
Sequence 2: Allergen Pac c 3.0101, Sequence: C0ITL3
Sequence identity: 50.00 (45/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           -------------A-HTMCQYTSP-P-P-C--YSN---T-A-K--I---H
Sequence 2 ---------TEGGAVHTMCQYTSPQPSPNCGTYSNAHITAADKETILKVH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ----------
           N--RQ-V--G-E-RG---PQP-A--MP-LTWD-ELA-IAQ----------
Sequence 2 NDERQKVKAGQETRGNPGPQPAASNMPDLTWDNELAAIAQRWVNQCKIGH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DGCRNVERYQVGQNIAMSGSTAKGPCNMNNLVQMWINEVNALNAADVSSM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCYLACNYGPAGN

Sequence 1 --------
           --------
Sequence 2 MFGAPIYQ



Alignment 5
Sequence 1:
Sequence 2: Allergen Ves vi 5, Sequence: P35787
Sequence identity: 46.67 (42/90)
Sequence 1 -TNYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIV
           --NYC----C------HT-C-Y---T--P-C--------G-T-AEK--I-
Sequence 2 KVNYCKIK-CLKGG-VHTACKYGTSTK-PNCGKMVVKAYGLTEAEKQEIL

Sequence 1 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------
           --HN--RQ-VA-G-E-RG---PQPPA--M-NL-W--ELA-IAQ-------
Sequence 2 KVHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YGHDTCKDTEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 WSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNF

Sequence 1 ---------
           ---------
Sequence 2 RNEKLYEKK



Alignment 6
Sequence 1:
Sequence 2: Allergen Pol f 5, Sequence: P35780
Sequence identity: 48.89 (44/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIV
           --YC----C-----IHT-CQY--S--P---C-------VG-T--EK--IV
Sequence 2 VDYCKIK-C--SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIV

Sequence 1 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------
           N-HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--ELA-IAQ-------
Sequence 2 NEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ILVHDKCRNTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYL

Sequence 1 --------
           --------
Sequence 2 GQLPYTKK



Alignment 7
Sequence 1:
Sequence 2: Allergen Poly p 5.0101, Sequence: C0HJV9
Sequence identity: 48.89 (44/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLEYS--NVGFTDAEKDAIV
           --YCN---C------HT-CQY--S--P---C---S---VG-T--EK--IV
Sequence 2 NKYCNIK-CSK--VAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIV

Sequence 1 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------
           --HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--ELA-IAQ-------
Sequence 2 DEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNY

Sequence 1 ---------
           ---------
Sequence 2 MGQPIYTKK



Alignment 8
Sequence 1:
Sequence 2: Allergen Vesp v 5.0101, Sequence: P0DMB9
Sequence identity: 47.78 (43/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVN
           -NYC----C-----IHT-C-Y---T--P-C--------G-T-AEK--I--
Sequence 2 NNYCKIK-CR--SGIHTLCKYGTSTK-PNCGRSVVKASGLTKAEKLEILK

Sequence 1 KHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ--------
           -HNE-RQ-VA-G-E-RG---PQPPA--M--L-W--ELA-IAQ--------
Sequence 2 QHNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GHDNCRNTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NKLNDVGHYTQMVWAKTKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGNE

Sequence 1 ------
           ------
Sequence 2 PIYEKK



Alignment 9
Sequence 1:
Sequence 2: Allergen Vesp m 5, Sequence: P81657
Sequence identity: 47.78 (43/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY---TSPTPGPMCLEYSNVGFTDAEKDAIV
           -NYC----C-----IHT-C-----T-P--G------S--G-T-AEK--I-
Sequence 2 NNYCKIK-CR--SGIHTLCKFGISTKPNCGKNVVKAS--GLTKAEKLEIL

Sequence 1 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------
           --HNE-RQ-VA-G-E-RG---PQPPA--M--L-W--ELA-IAQ-------
Sequence 2 KQHNEFRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YGHDVCRNTAKYSVGQNIAENGSTAASFASVSNMVQMWADEVKNYQYGST

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIGN

Sequence 1 -------
           -------
Sequence 2 EPIYERK



Alignment 10
Sequence 1:
Sequence 2: Allergen Ves g 5, Sequence: P35784
Sequence identity: 43.33 (39/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           -NYC----C------HT-C-Y-S--P----------G-T--EK--I---H
Sequence 2 NNYCKIK-CLKGG-VHTACKYESLKPNCANKKVVAYGLTKQEKQDILKEH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ----------
           N--RQ--A-G-E-RG---PQPPA--M-NL-W--ELA-IAQ----------
Sequence 2 NDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DTCRDVAKYPVGQNVALTGSTAAKYDNPVKLVKMWEDEVKDYNPKKKFSE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNFLKIGHYTQMVWANTKEVGCGSIKYIQDKWHKHYLVCNYGPSGNFGNE

Sequence 1 ------
           ------
Sequence 2 ELYQTK



Alignment 11
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: AAA28302
Sequence identity: 46.67 (42/90)
Sequence 1 ----------TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLEYSNVGFT
           -----------NYC----C-R---IHT-C---TS--P----------G--
Sequence 2 PIINLSFGEANNYCKIK-CSRG--IHTLCKFGTSMKPNCGSKLVKVHGVS

Sequence 1 DAEKDAIVNKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIA
           --EK--IVN-HN--RQ-VA-G-E-RG---PQPPA--M--L-W--ELA-IA
Sequence 2 NDEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIA

Sequence 1 Q-------------------------------------------------
           Q-------------------------------------------------
Sequence 2 QTWANQCSFGHDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENEV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLV

Sequence 1 ---------------
           ---------------
Sequence 2 CNYGPAGNYMDQPIY



Alignment 12
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: P10737
Sequence identity: 46.67 (42/90)
Sequence 1 ----------TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLEYSNVGFT
           -----------NYC----C-R---IHT-C---TS--P----------G--
Sequence 2 PIINLSFGEANNYCKIK-CSRG--IHTLCKFGTSMKPNCGSKLVKVHGVS

Sequence 1 DAEKDAIVNKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIA
           --EK--IVN-HN--RQ-VA-G-E-RG---PQPPA--M--L-W--ELA-IA
Sequence 2 NDEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIA

Sequence 1 Q-------------------------------------------------
           Q-------------------------------------------------
Sequence 2 QTWANQCSFGHDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENEV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLV

Sequence 1 ------------------
           ------------------
Sequence 2 CNYGPAGNYMDQPIYERK



Alignment 13
Sequence 1:
Sequence 2: Allergen Ves m 5, Sequence: P35760
Sequence identity: 43.33 (39/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           -NYC----C------HT-C-Y-S--P----------G-T--EK--I---H
Sequence 2 NNYCKIK-CLKGG-VHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ----------
           N--RQ--A-G-E-RG---PQPPA--M-NL-W--ELA-IAQ----------
Sequence 2 NDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DTCRDVAKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNFLKIGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNE

Sequence 1 ------
           ------
Sequence 2 ELYQTK



Alignment 14
Sequence 1:
Sequence 2: Allergen Ves f 5, Sequence: P35783
Sequence identity: 42.22 (38/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           -NYC----C------HT-C-Y-S--P----------G-T--EK--I---H
Sequence 2 NNYCKIK-CLKGG-VHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ----------
           N--RQ--A-G-E-RG---PQPPA--M-NL-W--ELA--AQ----------
Sequence 2 NDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DTCRDIAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNFLKTGHYTQMVWANTKEVGCGSIKFIQEKWHKHYLVCNYGPSGNFQNE

Sequence 1 ------
           ------
Sequence 2 ELYQTK



Alignment 15
Sequence 1:
Sequence 2: Allergen Pol d 5, Sequence: P81656
Sequence identity: 46.67 (42/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIV
           --YC----C------HT-CQY--S--P---C-------VG-T--EK--IV
Sequence 2 NDYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIV

Sequence 1 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------
           --HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--ELA-IAQ-------
Sequence 2 EEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNY

Sequence 1 ---------
           ---------
Sequence 2 LGQPIYTKK



Alignment 16
Sequence 1:
Sequence 2: Allergen Poly s 5.0101, Sequence: Q7Z156
Sequence identity: 47.78 (43/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY---TSPTPGPMC--LEYSNVGFTDAEKDA
           --YCN---C------HT-CQY---T-P-----C-------VG-T--EK--
Sequence 2 NKYCNIK-CSK--VAHTVCQYGESTKPS-SKNCNKVSITSVGVTEEEKKL

Sequence 1 IVNKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-----
           IV--HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--ELA-IAQ-----
Sequence 2 IVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAG

Sequence 1 -----------
           -----------
Sequence 2 NYMGQPIYTKK



Alignment 17
Sequence 1:
Sequence 2: Allergen Ves v 5, Sequence: Q05110
Sequence identity: 42.22 (38/90)
Sequence 1 -----------------------TNYCNLQSCKRNNAIHTMCQYTSPTPG
           ------------------------NYC----C------HT-C-Y-S--P-
Sequence 2 MEISGLVYLIIIVTIIDLPYGKANNYCKIK-CLKGG-VHTACKYGSLKPN

Sequence 1 PMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNSPQPPAVKMP
           ---------G-T--EK--I---HN--RQ--A-G-E-RG---PQPPA--M-
Sequence 2 CGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMK

Sequence 1 NLTWDPELATIAQ-------------------------------------
           NL-W--ELA--AQ-------------------------------------
Sequence 2 NLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTAAKYDD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKY

Sequence 1 -----------------------------
           -----------------------------
Sequence 2 IQEKWHKHYLVCNYGPSGNFMNEELYQTK



Alignment 18
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35782
Sequence identity: 45.56 (41/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVN
           -NYC----C-----IHT-C-Y---T--P-C--------G-T--E---I--
Sequence 2 NNYCKIK-CR--SGIHTLCKYGTSTK-PNCGKNVVKASGLTKQENLEILK

Sequence 1 KHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ--------
           -HNE-RQ-VA-G-E-RG---PQPPA--M--L-W--ELA-IAQ--------
Sequence 2 QHNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GHDNCRNSAKYSVGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQYGSPK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGWHRHYLVCNYGPAGNVGNE

Sequence 1 ------
           ------
Sequence 2 PIYERK



Alignment 19
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35781
Sequence identity: 45.56 (41/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVN
           -NYC----C-----IHT-C-Y---T--P-C--------G-T--E---I--
Sequence 2 NNYCKIK-CR--SGIHTLCKYGTSTK-PNCGKNVVKASGLTKQENLEILK

Sequence 1 KHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ--------
           -HNE-RQ-VA-G-E-RG---PQPPA--M--L-W--ELA-IAQ--------
Sequence 2 QHNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GHDNCRNSAKYSVGQNIAEGSTTADNFGSVSNMVKMWEDEVKDYQYGSPK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NKLNKVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNVGNE

Sequence 1 ------
           ------
Sequence 2 PIYERK



Alignment 20
Sequence 1:
Sequence 2: Allergen Ves p 5, Sequence: P35785
Sequence identity: 42.22 (38/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           -NYC----C------HT-C-Y-S--P----------G-T--EK--I---H
Sequence 2 NNYCKIK-CLKGG-VHTACKYGSLKPNCGNKIVVSYGLTKEEKQDILKEH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ----------
           N--RQ--A-G-E-RG---PQPPA--M-NL-W--ELA--AQ----------
Sequence 2 NDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DTCRDVAKYPVGQNVALTGSTADKYDNPVKLVKMWEDEVKDYNPKKKFSE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNFNKIGHYTQMVWANTKEIGCGSIKYIQNEWHKHYLVCNYGPSGNFGNE

Sequence 1 ------
           ------
Sequence 2 ELYQTK



Alignment 21
Sequence 1:
Sequence 2: Allergen Ves s 5, Sequence: P35786
Sequence identity: 44.44 (40/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVN
           --YC----C------HT-C-Y---T--P-C--------G-T-AEK--I--
Sequence 2 VDYCKIK-CLKGG-VHTACKYGTSTK-PNCGNMVVKSYGVTQAEKQEILK

Sequence 1 KHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ--------
           -HN--R--VA-G-E-RG---PQPPA--M-NL-W--ELA-IAQ--------
Sequence 2 IHNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GHDTCKDTTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFG

Sequence 1 --------
           --------
Sequence 2 NQEVYERK



Alignment 22
Sequence 1:
Sequence 2: Allergen Dol a 5, Sequence: Q05108
Sequence identity: 46.67 (42/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLEYSNVGFTDAEKDAIVNK
           -NYC----C------HT-C-Y-TS--P----------G-T--EK--IV--
Sequence 2 NNYCKI--CPKGT--HTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKR

Sequence 1 HNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ---------
           HNE-RQ-VA-G-E-RG---PQPPA--M--L-W--ELA-IAQ---------
Sequence 2 HNEFRQKVAQGLETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HDQCRNTAKYPVGQNVAIASTTGNSYQTMSYLIKMWEDEVKDYNPHKDLM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HNNFSKVGHYTQMVWGKTKEIGCGSVKYIENKWHTHYLVCNYGPAGNYMN

Sequence 1 -------
           -------
Sequence 2 QPVYERK



Alignment 23
Sequence 1:
Sequence 2: Allergen Dol m 5.0101, Sequence: P10736
Sequence identity: 43.33 (39/90)
Sequence 1 -----------------------TNYCNLQSCKRNNAIHTMCQYTSPTPG
           ------------------------NYC----C-----IHT-C--------
Sequence 2 MEIGGLVYLILIITIINLSFGETNNYCKIK-CRKG--IHTLCKFGTSMK-

Sequence 1 PMCLE--YSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNSPQPPAVK
           P-C--------G-T--EK--I---HN--RQ-VA-G-E-RG---PQPPA--
Sequence 2 PNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKN

Sequence 1 MPNLTWDPELATIAQ-----------------------------------
           M--L-W--ELA-IAQ-----------------------------------
Sequence 2 MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTATQF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSI

Sequence 1 -------------------------------
           -------------------------------
Sequence 2 KYIEDNWYTHYLVCNYGPGGNDFNQPIYERK



Alignment 24
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: P35759
Sequence identity: 46.67 (42/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIV
           --YC----C-----IHT-CQY--S--P---C-------VG-T--EK--IV
Sequence 2 VDYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIV

Sequence 1 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------
           --HN--RQ-VA-G-E-RG---PQP-A--M--L-W--ELA-IAQ-------
Sequence 2 SEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FLVHDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYL

Sequence 1 --------
           --------
Sequence 2 GQLPYTKK



Alignment 25
Sequence 1:
Sequence 2: Allergen Pol g 5, Sequence: P83377
Sequence identity: 45.56 (41/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIV
           --YC----C------HT-CQY--S--P---C-------VG-T--EK--IV
Sequence 2 NDYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIV

Sequence 1 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------
           --HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--E-A-IAQ-------
Sequence 2 EEHNRFRQKVAQGLETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMKIHYLICNYGPAGNY

Sequence 1 ---------
           ---------
Sequence 2 LGQPIYTKK



Alignment 26
Sequence 1:
Sequence 2: Allergen Pol a 5, Sequence: Q05109
Sequence identity: 46.67 (42/90)
Sequence 1 ----TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEK
           ------YC----C-----IHT-CQY--S--P---C-------VG-T--EK
Sequence 2 SSQGVDYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEK

Sequence 1 DAIVNKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ---
           --IV--HN--RQ-VA-G-E-RG---PQP-A--M--L-W--ELA-IAQ---
Sequence 2 KLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SQCQFLVHDKCRNTAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPA

Sequence 1 ------------
           ------------
Sequence 2 GNYLGQLPYTKK



Alignment 27
Sequence 1:
Sequence 2: Allergen Poly p 5.0102, Sequence: P86686
Sequence identity: 47.78 (43/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQY---TSPTPGPMCLEYS--NVGFTDAEKDA
           --YCN---C------HT-CQ----T-P-----C---S---VG-T--EK--
Sequence 2 NKYCNIK-CSK--VAHTVCQTGESTKPS-SKNCAKVSITSVGVTEEEKKL

Sequence 1 IVNKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-----
           IV--HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--ELA-IAQ-----
Sequence 2 IVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGVVKLIVLWENEVKDFNYN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAG

Sequence 1 -----------
           -----------
Sequence 2 NVLGAQIYEIK



Alignment 28
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: AAT95009
Sequence identity: 46.67 (42/90)
Sequence 1 ---------------------TNYCNLQSCKRNNAIHTMCQY-TSPTPGP
           -----------------------YC----C-----IHT-CQY--S--P--
Sequence 2 MEIGGLVYLVIVVAIIHSSQGVDYCKIR-CP--SGIHTVCQYGESTKPSK

Sequence 1 MCL--EYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNSPQPPAVKM
           -C-------VG-T--EK--IV--HN--RQ-VA-G-E-RG---PQP-A--M
Sequence 2 NCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDM

Sequence 1 PNLTWDPELATIAQ------------------------------------
           --L-W--ELA-IAQ------------------------------------
Sequence 2 NDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGGSKLPD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKY

Sequence 1 -----------------------------
           -----------------------------
Sequence 2 MENKMQNHYLICNYGPAGNYLGQLPNTKK



Alignment 29
Sequence 1:
Sequence 2: Allergen Cte f 2, Sequence: AAF65314
Sequence identity: 37.78 (34/90)
Sequence 1 -------------------------------TNYCNLQSCKRNNAIHTMC
           ---------------------------------YCNL--C---N-----C
Sequence 2 MNSLLSSIIIVVFSVWLSVIFAVNVKPKPNQDDYCNL-NC--TNGPNVGC

Sequence 1 QYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNSP
           --T-P-----C-----V--T---K-A--N-HN--R--VA-GK--------
Sequence 2 --TKPDVPRDCQNFKLVNITERMKKAFLNAHNRKRRLVAAGKGLLKDGVH

Sequence 1 QPPAVKMPNLTWDPELATIAQ-----------------------------
           -P-A-KMPNLTW---LA--A------------------------------
Sequence 2 TPIAAKMPNLTWNIALAKLAEYNVKQCEMKHDCAKTRHGHTGQNLFFYGT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TLSPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 WGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYRGGNMLEEAVYQIKDAKN

Sequence 1 -------------------
           -------------------
Sequence 2 PKSKNQTKNNKKPKQKMPK



Alignment 30
Sequence 1:
Sequence 2: Allergen Sco m 5.0101, Sequence: QEA69430
Sequence identity: 24.44 (22/90)
Sequence 1 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH
           ----------------------------M-------G-----K--I---H
Sequence 2 -------MTIFLTSTLFVLLVFQILGKGMGCDMKVRGLDANMKKMILDLH

Sequence 1 NELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ----------
           N--RQ-VA-G-------S-QP-A--M--L-WD---A--AQ----------
Sequence 2 NKKRQTVANGQQ-----SGQPSAANMKELHWDDQIAANAQRSAETCVFQH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TAKNLRKTSKYSYLGENIYMGSYPDPIPRSVNAWYDEVKDVTPAVVKSFR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SGGPMIGHYTQMVWANTEALGCGLVTASDKNTYIFCQYGPSGNYPGEPIY

Sequence 1 ----------------------
           ----------------------
Sequence 2 KQGSPASDCKKGKSSKYPGLCN



Alignment 31
Sequence 1:
Sequence 2: Allergen Tab y 5.0101, Sequence: ADM18345
Sequence identity: 32.22 (29/90)
Sequence 1 -----------------------TNYCNLQSCKRNNAIHTMCQYTSPTPG
           -------------------------YC-L--C------H--C---SP---
Sequence 2 MAPIIVPCLLLVVLVLQCSVINSLDYCSL--CRGGRGEHVGCG--SPGFS

Sequence 1 PMCLEYSNV-GFTDAEKDAIVNKHNELRQRVASGKEMRGTNSPQPPAVKM
           --C--------FT---K--I--K-N--R--VA-G----G-----P-A--M
Sequence 2 SDCGQKARTRKFTKEHKKVILDKINDVRDHVAKGSW--GL----PVASRM

Sequence 1 PNLTWDPELATIAQ------------------------------------
           ----WD-ELA--A-------------------------------------
Sequence 2 KVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEFYADKMPS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GCGLTTWKLGGKARALLTCNFSSENDYNRPVYKTGNSPGEKCIKKDETFK

Sequence 1 ----------------
           ----------------
Sequence 2 NLCSAQEPINPNEHNF


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.