The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pol d 5

Sequence P81656

Full FASTA alignment

Sequence name:
Query sequence:
NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
PIYTKK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pol d 5P81656Go!206334.71.3e-93
2Pol g 5P83377Go!206330.13.0e-92
3Pol a 5Q05109Go!209291.61.1e-80
4Pol f 5P35780Go!205290.91.8e-80
5Pol e 5.0101P35759Go!205289.16.4e-80
6Pol e 5.0101AAT95009Go!226285.58.8e-79
7Poly p 5.0101C0HJV9Go!206268.31.2e-73
8Poly s 5.0101Q7Z156Go!207267.61.9e-73
9Poly p 5.0102P86686Go!207262.66.4e-72
10Dol m 5.02P10737Go!215237.03.4e-64
11Dol m 5.02AAA28302Go!212235.11.2e-63
12Dol a 5Q05108Go!203226.64.1e-61
13Dol m 5.0101P10736Go!227222.39.1e-60
14Vesp c 5P35781Go!202213.82.9e-57
15Ves p 5P35785Go!204212.01.1e-56
16Ves vi 5P35787Go!206211.81.2e-56
17Ves s 5P35786Go!205211.12.0e-56
18Ves v 5Q05110Go!227210.92.5e-56
19Vesp v 5.0101P0DMB9Go!202210.62.7e-56
20Ves m 5P35760Go!204210.62.7e-56
21Vesp c 5P35782Go!202210.43.2e-56
22Vesp m 5P81657Go!202209.94.4e-56
23Ves f 5P35783Go!204209.75.2e-56
24Ves g 5P35784Go!204207.03.5e-55
25Pac c 3.0101C0ITL3Go!199162.57.9e-42
26Sol r 3P35779Go!211156.65.1e-40
27Sol i 3P35778Go!234156.08.9e-40
28Sco m 5.0101QEA69430Go!21096.09.2e-22
29Cte f 2AAF65314Go!26483.27.9e-18
30Sol s 3.0101ABC58726Go!9065.26.9e-13
31Glo m 5AAF82096Go!25966.58.4e-13
32Pol m 5.01017065471Go!3762.22.3e-12
33Art gm 2.0101AVD29825Go!16359.56.8e-11
34Art an 2.0101AVD29822Go!16359.56.8e-11
35Art si 2.0101AVD29827Go!16359.38.0e-11
36Art ar 2.0101A0A2L1DGQ3Go!16359.38.0e-11
37Art la 2.0101AVD29826Go!16359.38.0e-11
38Sol g 3.0101AAY32926Go!7057.61.1e-10
39Art ca 2.0101AVD29824Go!16358.61.3e-10
40Cyn d 24.0101AAU15051Go!15354.02.9e-09
41Tab y 5.0101ADM18345Go!25654.43.7e-09
42Pru p 9.0101XP_007199020Go!16138.91.1e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pol d 5, Sequence: P81656
Sequence identity: 100.00 (206/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
Sequence 2 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
Sequence 2 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
           KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
Sequence 2 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ

Sequence 1 PIYTKK
           PIYTKK
Sequence 2 PIYTKK



Alignment 2
Sequence 1:
Sequence 2: Allergen Pol g 5, Sequence: P83377
Sequence identity: 98.06 (202/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           NDYCKIKCSSGVHTVCQYGESTKPSKNCAGK-IKSVGPTEEEKKLIVEEH
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           NRFRQKVA-GLETRGNPGPQPAASNMNNLVWNDE-AKIAQVWASQCQILV
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILV

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
Sequence 2 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
           KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNM-IHYLICNYGPAGNYLGQ
Sequence 2 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMKIHYLICNYGPAGNYLGQ

Sequence 1 PIYTKK
           PIYTKK
Sequence 2 PIYTKK



Alignment 3
Sequence 1:
Sequence 2: Allergen Pol a 5, Sequence: Q05109
Sequence identity: 85.44 (176/206)
Sequence 1 ----NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLI
           -----DYCKIKC-SG-HTVCQYGESTKPSKNCAGK-IKSVGPTEEEKKLI
Sequence 2 SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLI

Sequence 1 VEEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQC
           V-EHNRFRQKVA-GLETRGNPGPQPAAS-MN-LVWNDELA-IAQVWASQC
Sequence 2 VSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC

Sequence 1 QILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNT
           Q-LVHDKCRNT-KY-VGQNIAYAG-SN--P-V--LI-LWENEVKDFNYNT
Sequence 2 QFLVHDKCRNTAKYPVGQNIAYAGGSN-LPDVVSLIKLWENEVKDFNYNT

Sequence 1 GITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGN
           GIT--NF-K-GHYTQMVWG-TKE-GCGSLKY-E-NMQ-HYLICNYGPAGN
Sequence 2 GITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPAGN

Sequence 1 YLGQPIYTKK
           YLGQ--YTKK
Sequence 2 YLGQLPYTKK



Alignment 4
Sequence 1:
Sequence 2: Allergen Pol f 5, Sequence: P35780
Sequence identity: 85.44 (176/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           -DYCKIKCSSG-HTVCQYGESTKPSKNCA-K-IKSVGPTEEEKKLIV-EH
Sequence 2 VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           NRFRQKVA-GLETRGNPGPQPAAS-MNNLVWNDELA-IAQVWASQCQILV
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILV

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           HDKCRNT-KYQVGQNIAYAG-S---P-V--LI-LWENEVKDFNYN-GIT-
Sequence 2 HDKCRNTAKYQVGQNIAYAGGSK-LPDVVSLIKLWENEVKDFNYNKGITK

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
           -NFGKVGHYTQM-W--TKE-GCGSLKY---NMQ-HYLICNYGPAGNYLGQ
Sequence 2 QNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQ

Sequence 1 PIYTKK
           --YTKK
Sequence 2 LPYTKK



Alignment 5
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: P35759
Sequence identity: 84.47 (174/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           -DYCKIKC-SG-HTVCQYGESTKPSKNCAGK-IKSVGPTEEEKKLIV-EH
Sequence 2 VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           NRFRQKVA-GLETRGNPGPQPAAS-MN-LVWNDELA-IAQVWASQCQ-LV
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLV

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           HDKCRNT-KY-VGQNIAYAG-S---P-V--LI-LWENEVKDFNYNTGIT-
Sequence 2 HDKCRNTAKYPVGQNIAYAGGSK-LPDVVSLIKLWENEVKDFNYNTGITK

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
           -NF-K-GHYTQMVWG-TKE-GCGSLKY-E--MQ-HYLICNYGPAGNYLGQ
Sequence 2 QNFAKIGHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQ

Sequence 1 PIYTKK
           --YTKK
Sequence 2 LPYTKK



Alignment 6
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: AAT95009
Sequence identity: 83.50 (172/206)
Sequence 1 ---------------------NDYCKIKCSSGVHTVCQYGESTKPSKNCA
           ----------------------DYCKI-C-SG-HTVCQYGESTKPSKNCA
Sequence 2 MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCA

Sequence 1 GKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNMNNL
           GK-IKSVGPTEEEKKLIV-EHNRFRQKVA-GLETRGNPGPQPAAS-MN-L
Sequence 2 GKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDL

Sequence 1 VWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVT
           VWNDELA-IAQVWASQCQ-LVHDKCRNT-KY-VGQNIAYAG-S---P-V-
Sequence 2 VWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGGSK-LPDVV

Sequence 1 KLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE
           -LI-LWENEVKDFNYNTGIT--NF-K-GHYTQMVWG-TKE-GCGSLKY-E
Sequence 2 SLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME

Sequence 1 KNMQIHYLICNYGPAGNYLGQPIYTKK
           --MQ-HYLICNYGPAGNYLGQ---TKK
Sequence 2 NKMQNHYLICNYGPAGNYLGQLPNTKK



Alignment 7
Sequence 1:
Sequence 2: Allergen Poly p 5.0101, Sequence: C0HJV9
Sequence identity: 77.18 (159/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           N-YC-IKCS---HTVCQYGESTKPS--C----I-SVG-TEEEKKLIV-EH
Sequence 2 NKYCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           NRFRQKVA-GLETRGNPGPQPAAS-MNNLVWNDELA-IAQVWASQCQ--V
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFV

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           HDKCRNT--YQVGQNIAY--S----P----LI-LWENEVKDFNY--GIT-
Sequence 2 HDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGITK

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
           -NF-KVGHYTQ-VW--TKEVGCGS-KY-EK-M--HYL-CNYGPAGNY-GQ
Sequence 2 ENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMGQ

Sequence 1 PIYTKK
           PIYTKK
Sequence 2 PIYTKK



Alignment 8
Sequence 1:
Sequence 2: Allergen Poly s 5.0101, Sequence: Q7Z156
Sequence identity: 77.67 (160/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPS-KNCAGKLIKSVGPTEEEKKLIVEE
           N-YC-IKCS---HTVCQYGESTKPS-KNC----I-SVG-TEEEKKLIV-E
Sequence 2 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE

Sequence 1 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL
           HNRFRQKVA-GLETRGNPGPQPAAS-MNNLVWNDELA-IAQVWA-QCQ--
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF

Sequence 1 VHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGIT
           VHDKCRNT--YQVGQNIAY--S----P----LI-LWENEVKDFNY--GIT
Sequence 2 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT

Sequence 1 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG
           --NF-KVGHYTQ-VW--TKEVGCGS-KY-EK-M--HYL-CNYGPAGNY-G
Sequence 2 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG

Sequence 1 QPIYTKK
           QPIYTKK
Sequence 2 QPIYTKK



Alignment 9
Sequence 1:
Sequence 2: Allergen Poly p 5.0102, Sequence: P86686
Sequence identity: 78.16 (161/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPS-KNCAGKLIKSVGPTEEEKKLIVEE
           N-YC-IKCS---HTVCQ-GESTKPS-KNCA---I-SVG-TEEEKKLIV-E
Sequence 2 NKYCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDE

Sequence 1 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL
           HNRFRQKVA-GLETRGNPGPQPAAS-MNNLVWNDELA-IAQVWASQCQ--
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFF

Sequence 1 VHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGIT
           VHDKCRNT--YQVGQNIAY--S----P-V-KLI-LWENEVKDFNYNTGIT
Sequence 2 VHDKCRNTAQYQVGQNIAYSASTAAYPGVVKLIVLWENEVKDFNYNTGIT

Sequence 1 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG
           --NF-KVGHYTQ-VW--TKEVGCGS-KY-EK-M--HYL-CNYGPAGN-LG
Sequence 2 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNVLG

Sequence 1 QPIYTKK
           --IY--K
Sequence 2 AQIYEIK



Alignment 10
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: P10737
Sequence identity: 66.99 (138/206)
Sequence 1 ----------NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTE
           ----------N-YCKIKCS-G-HT-C--G-S-KP--NC--KL-K--G---
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSN

Sequence 1 EEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQ
           -EK--IV--HN-FRQKVAKGLETRGNPGPQP-A-NMN-LVWNDELAKIAQ
Sequence 2 DEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQ

Sequence 1 VWASQCQILVHDKCRNTEKYQVGQNIAYAGSS-NHFPSVTKLIQLWENEV
           -WA-QC----HD-CRNTEKYQVGQN-A-A----N------KLI--WENEV
Sequence 2 TWANQCS-FGHDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENEV

Sequence 1 KDFNYNTG-ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLI
           KDFN---G-----NF-KVGHYTQMVWG-TKE-GCGS-KY-E-N---HYL-
Sequence 2 KDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLV

Sequence 1 CNYGPAGNYLGQPIYTKK
           CNYGPAGNY--QPIY--K
Sequence 2 CNYGPAGNYMDQPIYERK



Alignment 11
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: AAA28302
Sequence identity: 66.50 (137/206)
Sequence 1 ----------NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTE
           ----------N-YCKIKCS-G-HT-C--G-S-KP--NC--KL-K--G---
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSN

Sequence 1 EEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQ
           -EK--IV--HN-FRQKVAKGLETRGNPGPQP-A-NMN-LVWNDELAKIAQ
Sequence 2 DEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQ

Sequence 1 VWASQCQILVHDKCRNTEKYQVGQNIAYAGSS-NHFPSVTKLIQLWENEV
           -WA-QC----HD-CRNTEKYQVGQN-A-A----N------KLI--WENEV
Sequence 2 TWANQCS-FGHDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENEV

Sequence 1 KDFNYNTG-ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLI
           KDFN---G-----NF-KVGHYTQMVWG-TKE-GCGS-KY-E-N---HYL-
Sequence 2 KDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLV

Sequence 1 CNYGPAGNYLGQPIYTKK
           CNYGPAGNY--QPIY---
Sequence 2 CNYGPAGNYMDQPIY---



Alignment 12
Sequence 1:
Sequence 2: Allergen Dol a 5, Sequence: Q05108
Sequence identity: 63.11 (130/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           N-YCKI-C--G-HT-C-YG-S-KP--NC-GK--KS-G-T--EK--IV--H
Sequence 2 NNYCKI-CPKGTHTLCKYGTSMKP--NCGGKIVKSYGVTNDEKNEIVKRH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N-FRQKVA-GLETRGNPGPQP-A-NMN-LVWNDELAKIAQ-WA-QC----
Sequence 2 NEFRQKVAQGLETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCN-FG

Sequence 1 HDKCRNTEKYQVGQNIAYAGSS-NHFPSVTKLIQLWENEVKDFNYNTGIT
           HD-CRNT-KY-VGQN-A-A----N-------LI--WE-EVKD-N------
Sequence 2 HDQCRNTAKYPVGQNVAIASTTGNSYQTMSYLIKMWEDEVKDYNPHKDLM

Sequence 1 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG
           --NF-KVGHYTQMVWG-TKE-GCGS-KY-E-----HYL-CNYGPAGNY--
Sequence 2 HNNFSKVGHYTQMVWGKTKEIGCGSVKYIENKWHTHYLVCNYGPAGNYMN

Sequence 1 QPIYTKK
           QP-Y--K
Sequence 2 QPVYERK



Alignment 13
Sequence 1:
Sequence 2: Allergen Dol m 5.0101, Sequence: P10736
Sequence identity: 62.62 (129/206)
Sequence 1 -----------------------NDYCKIKCSSGVHTVCQYGESTKPSKN
           -----------------------N-YCKIKC--G-HT-C--G-S-KP--N
Sequence 2 MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKP--N

Sequence 1 CAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNMN
           C-----K--G-T--EK--I---HN-FRQ-VAKGLETRG-PGPQP-A-NMN
Sequence 2 CGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMN

Sequence 1 NLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGSS-NHFP
           -LVWNDELAKIAQ-WA-QC----HD-CRNT-KYQVGQNIA--------F-
Sequence 2 VLVWNDELAKIAQTWANQCD-FNHDDCRNTAKYQVGQNIAISSTTATQFD

Sequence 1 SVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLK
           ---KLI--WE-EV--FNY--G--N-NF-KVGHYTQMVWG-TKE-GCGS-K
Sequence 2 RPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIK

Sequence 1 YVEKNMQIHYLICNYGPAGNYLGQPIYTKK
           Y-E-N---HYL-CNYGP-GN---QPIY--K
Sequence 2 YIEDNWYTHYLVCNYGPGGNDFNQPIYERK



Alignment 14
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35781
Sequence identity: 59.71 (123/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           N-YCKIKC-SG-HT-C-YG-STKP--NC-----K--G-T--E---I---H
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IAQVWA-QC----
Sequence 2 NEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-

Sequence 1 HDKCRNTEKYQVGQNIAYAGSS-NHFPSVTKLIQLWENEVKDFNYNTGIT
           HD-CRN--KY-VGQNIA--------F-SV------WE-EVKD--Y--G--
Sequence 2 HDNCRNSAKYSVGQNIAEGSTTADNFGSVSNMVKMWEDEVKDYQY--GSP

Sequence 1 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG
           -----KVGHYTQMVW--TKE-GCGS-KY-E-----HYL-CNYGPAGN---
Sequence 2 KNKLNKVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNVGN

Sequence 1 QPIYTKK
           -PIY--K
Sequence 2 EPIYERK



Alignment 15
Sequence 1:
Sequence 2: Allergen Ves p 5, Sequence: P35785
Sequence identity: 59.22 (122/206)
Sequence 1 NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEE
           N-YCKIKC---GVHT-C-YG-S-KP--NC--K---S-G-T-EEK--I--E
Sequence 2 NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKIVVSYGLTKEEKQDILKE

Sequence 1 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL
           HN-FRQK-A-GLETRGNPGPQP-A-NM-NLVWNDELA--AQVWA-QCQ--
Sequence 2 HNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG

Sequence 1 VHDKCRNTEKYQVGQNIAYAGSS-NHFPSVTKLIQLWENEVKDFNYNTGI
           -HD-CR---KY-VGQN-A--GS---------KL---WE-EVKD-N-----
Sequence 2 -HDTCRDVAKYPVGQNVALTGSTADKYDNPVKLVKMWEDEVKDYNPKKKF

Sequence 1 TNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYL
           ---NF-K-GHYTQMVW-NTKE-GCGS-KY-------HYL-CNYGP-GN--
Sequence 2 SENNFNKIGHYTQMVWANTKEIGCGSIKYIQNEWHKHYLVCNYGPSGNFG

Sequence 1 GQPIYTKK
           ----Y--K
Sequence 2 NEELYQTK



Alignment 16
Sequence 1:
Sequence 2: Allergen Ves vi 5, Sequence: P35787
Sequence identity: 62.62 (129/206)
Sequence 1 -NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVE
           ---YCKIKC---GVHT-C-YG-STKP--NC-----K--G-TE-EK--I--
Sequence 2 KVNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILK

Sequence 1 EHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQI
           -HN-FRQKVAKGLETRGNPGPQP-A-NMNNLVWNDELA-IAQVWASQC--
Sequence 2 VHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNY

Sequence 1 LVHDKCRNTEKYQVGQNIA-YAGSSNHFPSVTKLIQLWENEVKDFNYNTG
           --HD-C--TEKY-VGQNIA--------F-S--KL---WENEVKDFN-N--
Sequence 2 G-HDTCKDTEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIE

Sequence 1 ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNY
           ----N--K-GHYTQMVW--TKE-GCGS-KYV------HYL-CNYGP-GN-
Sequence 2 WSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNF

Sequence 1 LGQPIYTKK
           -----Y-KK
Sequence 2 RNEKLYEKK



Alignment 17
Sequence 1:
Sequence 2: Allergen Ves s 5, Sequence: P35786
Sequence identity: 60.68 (125/206)
Sequence 1 NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEE
           -DYCKIKC---GVHT-C-YG-STKP--NC-----KS-G-T--EK--I---
Sequence 2 VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKI

Sequence 1 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL
           HN-FR-KVA-GLETRGNPGPQP-A-NMNNLVWN-ELA-IAQ-WASQC---
Sequence 2 HNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG

Sequence 1 VHDKCRNTEKYQVGQNIAYAGSSNH-FPSVTKLIQLWENEVKDFNYNTGI
           -HD-C--T-KY-VGQNIA---S-------V--L---WENEVKDFN-----
Sequence 2 -HDTCKDTTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISW

Sequence 1 TNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYL
           ----F-K-GHYTQMVW--TKE-GCGS-KYV--N---HYL-CNYGPAGN--
Sequence 2 EQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFG

Sequence 1 GQPIYTKK
           -Q--Y--K
Sequence 2 NQEVYERK



Alignment 18
Sequence 1:
Sequence 2: Allergen Ves v 5, Sequence: Q05110
Sequence identity: 59.22 (122/206)
Sequence 1 -----------------------NDYCKIKC-SSGVHTVCQYGESTKPSK
           -----------------------N-YCKIKC---GVHT-C-YG-S-KP--
Sequence 2 MEISGLVYLIIIVTIIDLPYGKANNYCKIKCLKGGVHTACKYG-SLKP--

Sequence 1 NCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNM
           NC--K---S-G-T--EK--I--EHN-FRQK-A-GLETRGNPGPQP-A-NM
Sequence 2 NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNM

Sequence 1 NNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGSSN-HF
           -NLVWNDELA--AQVWA-QCQ---HD-CR---KYQVGQN-A--GS-----
Sequence 2 KNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYQVGQNVALTGSTAAKY

Sequence 1 PSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSL
           ----KL---WE-EVKD-N---------F-K-GHYTQMVW-NTKEVGCGS-
Sequence 2 DDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSI

Sequence 1 KYVEKNMQIHYLICNYGPAGNYLGQPIYTKK
           KY-------HYL-CNYGP-GN------Y--K
Sequence 2 KYIQEKWHKHYLVCNYGPSGNFMNEELYQTK



Alignment 19
Sequence 1:
Sequence 2: Allergen Vesp v 5.0101, Sequence: P0DMB9
Sequence identity: 59.71 (123/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           N-YCKIKC-SG-HT-C-YG-STKP--NC-----K--G-T--EK--I---H
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKP--NCGRSVVKASGLTKAEKLEILKQH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IAQVWASQC----
Sequence 2 NEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYG-

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSN-HFPSVTKLIQLWENEVKDFNYNTGIT
           HD-CRNT-KY-VGQNIA--------F--V------W--EVKD--Y--G--
Sequence 2 HDNCRNTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQY--GSS

Sequence 1 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG
           ------VGHYTQMVW--TKE-GCG--KY-E-----HYL-CNYGPAGN---
Sequence 2 KNKLNDVGHYTQMVWAKTKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGN

Sequence 1 QPIYTKK
           -PIY-KK
Sequence 2 EPIYEKK



Alignment 20
Sequence 1:
Sequence 2: Allergen Ves m 5, Sequence: P35760
Sequence identity: 60.19 (124/206)
Sequence 1 NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEE
           N-YCKIKC---GVHT-C-YG-S-KP--NC--K---S-G-T--EK--I--E
Sequence 2 NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKE

Sequence 1 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL
           HN-FRQK-A-GLETRGNPGPQP-A-NM-NLVW-DELA-IAQVWA-QCQ--
Sequence 2 HNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG

Sequence 1 VHDKCRNTEKYQVGQNIAYAGSSNH-FPSVTKLIQLWENEVKDFNYNTGI
           -HD-CR---KYQVGQN-A--GS---------KL---WE-EVKD-N-----
Sequence 2 -HDTCRDVAKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKF

Sequence 1 TNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYL
           ---NF-K-GHYTQMVW-NTKEVGCGS-KY---N---HYL-CNYGP-GN--
Sequence 2 SENNFLKIGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQ

Sequence 1 GQPIYTKK
           ----Y--K
Sequence 2 NEELYQTK



Alignment 21
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35782
Sequence identity: 59.22 (122/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           N-YCKIKC-SG-HT-C-YG-STKP--NC-----K--G-T--E---I---H
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IAQVWA-QC----
Sequence 2 NEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-

Sequence 1 HDKCRNTEKYQVGQNIAYAGSS-NHFPSVTKLIQLWENEVKDFNYNTGIT
           HD-CRN--KY-VGQNIA----S---F--V------WE-EVKD--Y--G--
Sequence 2 HDNCRNSAKYSVGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQY--GSP

Sequence 1 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG
           -----KVGHYTQMVW--TKE-GCGS--Y-E-----HYL-CNYGPAGN---
Sequence 2 KNKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGWHRHYLVCNYGPAGNVGN

Sequence 1 QPIYTKK
           -PIY--K
Sequence 2 EPIYERK



Alignment 22
Sequence 1:
Sequence 2: Allergen Vesp m 5, Sequence: P81657
Sequence identity: 60.19 (124/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           N-YCKIKC-SG-HT-C--G-STKP--NC-----K--G-T--EK--I---H
Sequence 2 NNYCKIKCRSGIHTLCKFGISTKP--NCGKNVVKASGLTKAEKLEILKQH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N-FRQKVA-GLETRG-PGPQP-A--MN-LVWNDELA-IAQVWA-QC----
Sequence 2 NEFRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYG-

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSN-HFPSVTKLIQLWENEVKDFNYNTGIT
           HD-CRNT-KY-VGQNIA--GS----F-SV----Q-W--EVK---Y--G-T
Sequence 2 HDVCRNTAKYSVGQNIAENGSTAASFASVSNMVQMWADEVKNYQY--GST

Sequence 1 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG
           ------VGHYTQMVW--TKE-GCGS-KY-E-----HYL-CNYGPAGN---
Sequence 2 KNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIGN

Sequence 1 QPIYTKK
           -PIY--K
Sequence 2 EPIYERK



Alignment 23
Sequence 1:
Sequence 2: Allergen Ves f 5, Sequence: P35783
Sequence identity: 59.22 (122/206)
Sequence 1 NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEE
           N-YCKIKC---GVHT-C-YG-S-KP--NC--K---S-G-T--EK--I--E
Sequence 2 NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKE

Sequence 1 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL
           HN-FRQK-A-GLETRGNPGPQP-A-NM-NLVWNDELA--AQVWA-QCQ--
Sequence 2 HNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG

Sequence 1 VHDKCRNTEKYQVGQNIAYAGSSN-HFPSVTKLIQLWENEVKDFNYNTGI
           -HD-CR---KYQVGQN-A--GS---------KL---WE-EVKD-N-----
Sequence 2 -HDTCRDIAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKF

Sequence 1 TNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYL
           ---NF-K-GHYTQMVW-NTKEVGCGS-K--------HYL-CNYGP-GN--
Sequence 2 SGNNFLKTGHYTQMVWANTKEVGCGSIKFIQEKWHKHYLVCNYGPSGNFQ

Sequence 1 GQPIYTKK
           ----Y--K
Sequence 2 NEELYQTK



Alignment 24
Sequence 1:
Sequence 2: Allergen Ves g 5, Sequence: P35784
Sequence identity: 59.22 (122/206)
Sequence 1 NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEE
           N-YCKIKC---GVHT-C-Y-ES-KP--NCA-K-----G-T--EK--I--E
Sequence 2 NNYCKIKCLKGGVHTACKY-ESLKP--NCANKKVVAYGLTKQEKQDILKE

Sequence 1 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL
           HN-FRQK-A-GLETRGNPGPQP-A-NM-NLVW-DELA-IAQVWA-QCQ--
Sequence 2 HNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG

Sequence 1 VHDKCRNTEKYQVGQNIAYAGSSN-HFPSVTKLIQLWENEVKDFNYNTGI
           -HD-CR---KY-VGQN-A--GS---------KL---WE-EVKD-N-----
Sequence 2 -HDTCRDVAKYPVGQNVALTGSTAAKYDNPVKLVKMWEDEVKDYNPKKKF

Sequence 1 TNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYL
           ---NF-K-GHYTQMVW-NTKEVGCGS-KY-------HYL-CNYGP-GN--
Sequence 2 SENNFLKIGHYTQMVWANTKEVGCGSIKYIQDKWHKHYLVCNYGPSGNFG

Sequence 1 GQPIYTKK
           ----Y--K
Sequence 2 NEELYQTK



Alignment 25
Sequence 1:
Sequence 2: Allergen Pac c 3.0101, Sequence: C0ITL3
Sequence identity: 49.51 (102/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           -----------VHT-CQY--S--PS-NC----------T---K--I---H
Sequence 2 ------TEGGAVHTMCQY-TSPQPSPNCG--TYSNAHITAADKETILKVH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N--RQKV--G-ETRGNPGPQPAASNM--L-W--ELA-IAQ-W--QC-I--
Sequence 2 NDERQKVKAGQETRGNPGPQPAASNMPDLTWDNELAAIAQRWVNQCKIG-

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFP-SVTKLIQLWENEVKDFN---YNT
           HD-CRN-E-YQVGQNIA--GS----P-----L-Q-W-NEV---N------
Sequence 2 HDGCRNVERYQVGQNIAMSGSTAKGPCNMNNLVQMWINEVNALNAADVSS

Sequence 1 GITNKN-FGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAG
           -----N-F-K-GHYTQ-VWG-T--VGCG------------YL-CNYGPAG
Sequence 2 MPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCYLACNYGPAG

Sequence 1 NYLGQPIYTKK
           N--G-PIY---
Sequence 2 NMFGAPIYQ--



Alignment 26
Sequence 1:
Sequence 2: Allergen Sol r 3, Sequence: P35779
Sequence identity: 50.49 (104/206)
Sequence 1 NDYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIV
           --YC----C------HT-CQY--S--P---C-------VG-T--EK--IV
Sequence 2 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIV

Sequence 1 EEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQ
           --HN--RQ-VA-G-E-RG--GPQP-A--M-NL-W--ELA-IAQ-WA-QC-
Sequence 2 NKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT

Sequence 1 ILVHDKCRNTEKYQVGQNIAYAGSSNHFPS-VTKLIQLWENEVKDFNYNT
           ---HD-CRN-E---VGQNIA---SS----S-----I-LW-NEVKDF--N-
Sequence 2 -FEHDACRNVERFAVGQNIAATSSSGKNKSTLSDMILLWYNEVKDFD-NR

Sequence 1 GITN-----KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNY
           -I------------VGHYTQ-VW--TK--GCG-----E-N---HYL-CNY
Sequence 2 WISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRIMFKEDNWNKHYLVCNY

Sequence 1 GPAGNYLGQPIYTKK-
           GPAGN-LG--IY--K-
Sequence 2 GPAGNVLGAQIYEIKK



Alignment 27
Sequence 1:
Sequence 2: Allergen Sol i 3, Sequence: P35778
Sequence identity: 50.97 (105/206)
Sequence 1 ----------------------NDYCKIK-C--SSGVHTVCQYGESTKPS
           ------------------------YC----C------HT-CQY--S--P-
Sequence 2 MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQY-TSPTPG

Sequence 1 KNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASN
           --C-------VG-T--EK--IV--HN--RQ-VA-G-E-RG--GPQP-A--
Sequence 2 PMCLE--YSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVK

Sequence 1 MNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGSSNHF
           M-NL-W--ELA-IAQ-WA-QC----HD-CRN-E---VGQNIA---SS---
Sequence 2 MPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAATSSSGKN

Sequence 1 PSV-TKLIQLWENEVKDFNYNTGIT-----NKNFGKVGHYTQMVWGNTKE
           -S-----I-LW-NEVKDF--N--I-----------KVGHYTQ-VW--T--
Sequence 2 KSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTK

Sequence 1 VGCGSLKYVEK-NMQIHYLICNYGPAGNYLGQPIYTKK-
           -GCG-----E--N---HYL-CNYGPAGN-LG-PIY--K-
Sequence 2 IGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK



Alignment 28
Sequence 1:
Sequence 2: Allergen Sco m 5.0101, Sequence: QEA69430
Sequence identity: 34.95 (72/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           -----------------------------G---K--G-----KK-I---H
Sequence 2 -------MTIFLTSTLFVLLVFQILGKGMGCDMKVRGLDANMKKMILDLH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N--RQ-VA-G----G----QP-A-NM--L-W-D--A--AQ--A--C----
Sequence 2 NKKRQTVANGQQS-G----QPSAANMKELHWDDQIAANAQRSAETC-VFQ

Sequence 1 H--DKCRNTEKYQ-VGQNIAYAGSSNHFPS-VTKLIQLWENEVKDFNYNT
           H-----R-T-KY---G-NI-Y-GS----P---------W--EVKD-----
Sequence 2 HTAKNLRKTSKYSYLGENI-YMGS---YPDPIPRSVNAWYDEVKDVTPAV

Sequence 1 GITNKNFGK-VGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAG
           -------G---GHYTQMVW-NT---GCG------KN----Y--C-YGP-G
Sequence 2 VKSFRSGGPMIGHYTQMVWANTEALGCGLVTASDKNT---YIFCQYGPSG

Sequence 1 NYLGQPIYTKK-------------------
           NY-G-PIY----------------------
Sequence 2 NYPGEPIYKQGSPASDCKKGKSSKYPGLCN



Alignment 29
Sequence 1:
Sequence 2: Allergen Cte f 2, Sequence: AAF65314
Sequence identity: 36.41 (75/206)
Sequence 1 -------------------------------NDYCKIKCSSGVHTVCQYG
           --------------------------------DYC---C--G----C---
Sequence 2 MNSLLSSIIIVVFSVWLSVIFAVNVKPKPNQDDYCNLNCTNGPNVGC---

Sequence 1 ESTKPS--KNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNP
           --TKP-----C-----K-V--TE--KK-----HNR-R--VA-G-------
Sequence 2 --TKPDVPRDCQN--FKLVNITERMKKAFLNAHNRKRRLVAAGKGLLKDG

Sequence 1 GPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIA
           ---P-A--M-NL-WN--LAK-A-----QC----HD-C--T-----GQN--
Sequence 2 VHTPIAAKMPNLTWNIALAKLAEYNVKQCE-MKHD-CAKTRHGHTGQNLF

Sequence 1 YAGSS---NHFPSVTKL-IQLWENEVKDF---NYNTGITNKNFGK-VGHY
           --G------------K-----W--E-KD----------T----GK--GHY
Sequence 2 FYGTTLSPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHY

Sequence 1 TQMVWGNTKEVGCGSLKYVEK---NM-QIHYLICNYGPAGNYLGQPIYTK
           TQ--WGNT--VGC----Y------NM-------CNY---GN-L----Y--
Sequence 2 TQLIWGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQI

Sequence 1 K-----------------------
           K-----------------------
Sequence 2 KDAKNPKSKNQTKNNKKPKQKMPK



Alignment 30
Sequence 1:
Sequence 2: Allergen Sol s 3.0101, Sequence: ABC58726
Sequence identity: 20.39 (42/206)
Sequence 1 NDYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIV
           --YC----C------HT-CQY--S--P---C-------VG-T--EK--IV
Sequence 2 TNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIV

Sequence 1 EEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQ
           --HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--ELA-IAQ-------
Sequence 2 NKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-------

Sequence 1 ILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGQPIYTKK
           ---------
Sequence 2 ---------



Alignment 31
Sequence 1:
Sequence 2: Allergen Glo m 5, Sequence: AAF82096
Sequence identity: 32.04 (66/206)
Sequence 1 -------------------NDYCKIKCSSGVHTVCQYGESTKPSKNCAGK
           --------------------DYC---C----H--C--------------K
Sequence 2 MNFVLATLSLLILGSAAVGGDYCGL-CDN--HDACVMQNVFQSGCPSGAK

Sequence 1 LIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVW
           -I----------------HN--R--VA-G-E----------A--M----W
Sequence 2 MID----LNKYQSALLDAHNKKRNHVAGGGESK-----LKRACQMATMKW

Sequence 1 NDELAKIAQVWASQCQILVHDKCRNTEKYQ-VGQNIAYAGSSNHFPS---
           --ELAK-A-----QCQ---HD-CRNT-K----GQN-A--G-S---P----
Sequence 2 DSELAKLAEYNVKQCQ-MNHDRCRNTVKFKYAGQNLAELGRSGGPPPDYR

Sequence 1 --VTKLIQLWENEVKDFN---YNTGITNKNFGKVGHYTQMVWGNTKEVGC
           ----K----W--EVKD-N---------N------GH-T-MV------VGC
Sequence 2 KLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHVGC

Sequence 1 GSLKYVEKN-MQIHYLICNYGPAGNYLGQPIYTKK---------------
           ----Y---N--Q-----CNY----N----PIY------------------
Sequence 2 AASEYTKSNGFQYFLMACNYATT-NMMEFPIYKSCGSSAQDCKSGKNSKY

Sequence 1 -----------------------
           -----------------------
Sequence 2 PNLCSPNEKYEVNKWIKNGVEYH



Alignment 32
Sequence 1:
Sequence 2: Allergen Pol m 5.0101, Sequence: 7065471
Sequence identity: 16.02 (33/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           -DYCKIKCSSG-HTVCQYGESTKPSKNCA-K-IKSVG-------------
Sequence 2 VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG-------------

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PIYTKK
           ------
Sequence 2 ------



Alignment 33
Sequence 1:
Sequence 2: Allergen Art gm 2.0101, Sequence: AVD29825
Sequence identity: 29.61 (61/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           ----------------------------------------------V---
Sequence 2 -------------------------------------MGHLRNISLVLAI

Sequence 1 NRFRQKVAKGLETRGNPGPQPA----ASN-------MNNLVWNDELAKIA
           -----------ET-G-PG--P-----A-N-------M--L-W-DELAK-A
Sequence 2 SFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVA

Sequence 1 QVWAS----QCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLW
           Q-WA------C-----D-C--------G-N-A--G--N---------QLW
Sequence 2 QAWAETRTPDCSLVHSDRC--------GENMAQ-GAING----SMAVQLW

Sequence 1 ENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIH
           --E--D--YN----NK-----GHYTQ-VW-NT--VGCG-------N----
Sequence 2 LDERLDYDYNE---NKCIKMCGHYTQIVWANTERVGCG--RALCSNGWAY

Sequence 1 YLICNYGPAGNYLGQPIYTKK
           ---CNY-P-GN--GQ--Y---
Sequence 2 ITVCNYDPPGNVVGQKPY---



Alignment 34
Sequence 1:
Sequence 2: Allergen Art an 2.0101, Sequence: AVD29822
Sequence identity: 29.61 (61/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           ----------------------------------------------V---
Sequence 2 -------------------------------------MGHLRNISLVLAI

Sequence 1 NRFRQKVAKGLETRGNPGPQPA----ASN-------MNNLVWNDELAKIA
           -----------ET-G-PG--P-----A-N-------M--L-W-DELAK-A
Sequence 2 LFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVA

Sequence 1 QVWAS----QCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLW
           Q-WA------C-----D-C--------G-N-A--G--N---------QLW
Sequence 2 QAWAETRTPDCSLVHSDRC--------GENMAQ-GAING----SMAVQLW

Sequence 1 ENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIH
           --E--D--YN----NK-----GHYTQ-VW-NT--VGCG-------N----
Sequence 2 LDERLDYDYNE---NKCIKMCGHYTQIVWANTERVGCG--RALCSNGWAY

Sequence 1 YLICNYGPAGNYLGQPIYTKK
           ---CNY-P-GN--GQ--Y---
Sequence 2 ITVCNYDPPGNVVGQKPY---



Alignment 35
Sequence 1:
Sequence 2: Allergen Art si 2.0101, Sequence: AVD29827
Sequence identity: 29.13 (60/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           ----------------------------------------------V---
Sequence 2 -------------------------------------MGHLRNISLVLAI

Sequence 1 NRFRQKVAKGLETRGNPGPQPA----ASN-------MNNLVWNDELAKIA
           -----------ET-G-PG--P-----A-N-------M--L-W-DELAK-A
Sequence 2 SFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVA

Sequence 1 QVWA----SQCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLW
           Q-WA------C-----D-C--------G-N-A--G--N---------QLW
Sequence 2 QAWAEARTADCSLVHSDRC--------GENMAQ-GAING----SMAVQLW

Sequence 1 ENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIH
           --E--D--YN----NK-----GHYTQ-VW-N---VGCG-------N----
Sequence 2 LDERLDYDYNE---NKCIKMCGHYTQIVWANSERVGCG--RALCSNGWAY

Sequence 1 YLICNYGPAGNYLGQPIYTKK
           ---CNY-P-GN--GQ--Y---
Sequence 2 IIVCNYDPPGNVVGQKPY---



Alignment 36
Sequence 1:
Sequence 2: Allergen Art ar 2.0101, Sequence: A0A2L1DGQ3
Sequence identity: 29.13 (60/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           ----------------------------------------------V---
Sequence 2 -------------------------------------MGHLRNISLVLAI

Sequence 1 NRFRQKVAKGLETRGNPGPQPA----ASN-------MNNLVWNDELAKIA
           -----------ET-G-PG--P-----A-N-------M--L-W-DELAK-A
Sequence 2 SFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVA

Sequence 1 QVWAS----QCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLW
           Q-WA------C-----D-C--------G-N-A--G--N---------QLW
Sequence 2 QAWAETRTPDCSLIHSDRC--------GENMAQ-GAING----SMAVQLW

Sequence 1 ENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIH
           --E--D--YN----NK-----GHYTQ-VW-N---VGCG-------N----
Sequence 2 LDERLDYDYNE---NKCIKMCGHYTQIVWANSERVGCG--RALCSNGWAY

Sequence 1 YLICNYGPAGNYLGQPIYTKK
           ---CNY-P-GN--GQ--Y---
Sequence 2 IIVCNYDPPGNVVGQKPY---



Alignment 37
Sequence 1:
Sequence 2: Allergen Art la 2.0101, Sequence: AVD29826
Sequence identity: 29.13 (60/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           ----------------------------------------------V---
Sequence 2 -------------------------------------MGHLRNISLVLAI

Sequence 1 NRFRQKVAKGLETRGNPGPQPA----ASN-------MNNLVWNDELAKIA
           -----------ET-G-PG--P-----A-N-------M--L-W-DELAK-A
Sequence 2 SFAILHSSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVA

Sequence 1 QVWAS----QCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLW
           Q-WA------C-----D-C--------G-N-A--G--N---------QLW
Sequence 2 QAWAETRTPDCSLIHSDRC--------GENMAQ-GAING----SMAVQLW

Sequence 1 ENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIH
           --E--D--YN----NK-----GHYTQ-VW-N---VGCG-------N----
Sequence 2 LDERLDYDYNE---NKCIKMCGHYTQIVWANSERVGCG--RALCSNGWAY

Sequence 1 YLICNYGPAGNYLGQPIYTKK
           ---CNY-P-GN--GQ--Y---
Sequence 2 IIVCNYDPPGNVVGQKPY---



Alignment 38
Sequence 1:
Sequence 2: Allergen Sol g 3.0101, Sequence: AAY32926
Sequence identity: 14.56 (30/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           --------------------------------------------------
Sequence 2 --------------------------------------DNRWISSFPSDP

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEK-NMQIHYLICNYGPAGNYLG
           ----K-GHYTQ-VW--T---GCG-----E--N---HYL-CNYGPAGN-LG
Sequence 2 NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG

Sequence 1 QPIYTKK-
           --IY--K-
Sequence 2 AKIYEIKK



Alignment 39
Sequence 1:
Sequence 2: Allergen Art ca 2.0101, Sequence: AVD29824
Sequence identity: 29.13 (60/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           --------------------------------------------L-V---
Sequence 2 -------------------------------------MGHLRNILLVLAI

Sequence 1 NRFRQKVAKGLETRGNPGPQPA----ASN-------MNNLVWNDELAKIA
           ------------T-G-PG--P-----A-N-------M--L-W-DELAK-A
Sequence 2 SFAILHLSHAHGTYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVA

Sequence 1 QVWA----SQCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLW
           Q-WA------C-----D-C--------G-N-A--G--N---------QLW
Sequence 2 QAWAETRTPDCSLIHSDRC--------GENMAQ-GAING----SMAVQLW

Sequence 1 ENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIH
           --E--D--YN----NK-----GHYTQ-VW-N---VGCG-------N----
Sequence 2 LDERLDYDYNE---NKCIKMCGHYTQIVWANSERVGCG--RALCSNGWAY

Sequence 1 YLICNYGPAGNYLGQPIYTKK
           ---CNY-P-GN--GQ--Y---
Sequence 2 IIVCNYDPPGNVVGQKPY---



Alignment 40
Sequence 1:
Sequence 2: Allergen Cyn d 24.0101, Sequence: AAU15051
Sequence identity: 19.42 (40/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           --------------------------------------------------
Sequence 2 ------------------------------------------STQLPSDE

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           ---------------------A------L-WN--LAK--Q--A-----L-
Sequence 2 PLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESK--LK

Sequence 1 HDKCRNTEK-YQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGIT
           -D-C---------G-N-------------------W--E-K---Y-----
Sequence 2 KD-CKMVHSDSPYGENLMFGSGAISWKTT---VDTWSDEKKSYHYGSNTC

Sequence 1 NKNFGKV-GHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYL
           ----GK--GHYT--VW--T--VGCG------K--------C-Y-P-GNY-
Sequence 2 DQ--GKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTM--IMCSYWPPGNYE

Sequence 1 GQPIYTKK
           -Q--Y---
Sequence 2 NQKPY---



Alignment 41
Sequence 1:
Sequence 2: Allergen Tab y 5.0101, Sequence: ADM18345
Sequence identity: 27.18 (56/206)
Sequence 1 -----------------------NDYCKI-KCSSGVHTVCQYGESTKPSK
           ------------------------DYC-------G-H--C----S---S-
Sequence 2 MAPIIVPCLLLVVLVLQCSVINSLDYCSLCRGGRGEHVGCG---SPGFSS

Sequence 1 NCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNM
           -C-G--------T-E-KK-I----N--R--VAKG----G-----P-AS-M
Sequence 2 DC-GQKARTRKFTKEHKKVILDKINDVRDHVAKG--SWG----LPVASRM

Sequence 1 NNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGSSNHFP
           ---VW--ELA--A------C------KCR-T------------------P
Sequence 2 KVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFEFYADKMP

Sequence 1 SVTKLIQ--LWENEVKDFNYNTGITNKN-----FGKVGHYTQMVWGNTKE
           S---LI------------N----I--K-------G-V-------------
Sequence 2 STMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTA

Sequence 1 VGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIYTKK-------------
           VGCG-------------L-CN------Y---P-Y----------------
Sequence 2 VGCGLTTWKLGGKARALLTCNFSSENDY-NRPVYKTGNSPGEKCIKKDET

Sequence 1 ------------------
           ------------------
Sequence 2 FKNLCSAQEPINPNEHNF



Alignment 42
Sequence 1:
Sequence 2: Allergen Pru p 9.0101, Sequence: XP_007199020
Sequence identity: 24.76 (51/206)
Sequence 1 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH
           ----------------------------------S-----EE----VEEH
Sequence 2 -------------MAFNTKLLLAICCVALVFTLVSANISKEEIDGFVEEH

Sequence 1 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV
           N--R--V----------G--P-------L-WN--LA--AQ--A------V
Sequence 2 NKARKEV----------GNKP-------LKWNTTLAQYAQEYADK---RV

Sequence 1 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN
           -D----------G-N-A--G--------TK----W--E------------
Sequence 2 GDCAMEHSMGRWGENLA-SGDGMSGAAATKY---WVTEKEFYDEKSNKCV

Sequence 1 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQ
           K-----GHY---VWG-T-EVGCG--K----N-Q--Y--C-Y-P-------
Sequence 2 KD--ECGHYLAVVWGKTTEVGCGISKC--NNGQ-NYVVCSYDPMYQPEDE

Sequence 1 PIYTKK
           --Y---
Sequence 2 RPY---


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.