The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ses i 3

Sequence 13183177

Full FASTA alignment

Sequence name:
Query sequence:
MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR
DRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQ
RPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATK
IALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVII
PAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKEL
AFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ses i 3AAK15089Go!585665.13.4e-192
2Pis v 3.0101EF116865Go!519299.43.7e-82
3Cor a 11AAL86739Go!448285.55.0e-78
4Ana o 1.0102AAM73729Go!536275.75.3e-75
5Ana o 1.0101AAM73730Go!538275.56.0e-75
6Mac i 1.0201Q9SPL4Go!666241.21.6e-64
7Mac i 1.0101Q9SPL3Go!625239.83.8e-64
8Jug r 6.0101A0A2I4E5L6Go!502238.48.3e-64
9Car i 2.0101B3STU4Go!792233.93.0e-62
10Jug r 2AAF18269Go!593227.61.7e-60
11Jug n 2AAM54366Go!481195.75.7e-51
12Pin k 2.0101V9VGU0Go!463183.13.3e-47
13Gly m conglycininAAB23463Go!439151.11.3e-37
14Gly m 5.0201Q9FZP9Go!559125.96.7e-30
15Gly m conglycininCAA35691Go!605122.29.8e-29
16Gly m 5.0101O22120Go!543115.21.1e-26
17Lup an 1.0101ACB05815Go!611108.21.6e-24
18Vig r 2.0101Q198W3Go!453106.34.2e-24
19Ara h 1P43238Go!626101.81.4e-22
20Ara h 1P43237Go!61499.18.7e-22
21Vig r 2.0201B1NPN8Go!45489.54.9e-19
22Len c 1.0102CAD87731Go!41583.43.2e-17
23Gly m conglycininAAB01374Go!63983.64.1e-17
24Len c 1.0101CAD87730Go!41882.75.0e-17
25Gly m conglycininAAA33947Go!21867.21.3e-12
26Coc n 1.0101A0A0S3B0K0Go!49057.42.4e-09
27Gly m Bd28KBAB21619Go!47357.13.0e-09
28Pru du 8.0101A0A516F3L2Go!26446.72.2e-06
29Fag e 3.0101A5HIX6Go!13638.92.6e-04
30Ses i 7.0101Q9AUD2Go!49737.81.9e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 100.00 (585/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
Sequence 2 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
Sequence 2 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
Sequence 2 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
Sequence 2 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED

Sequence 1 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
           QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
Sequence 2 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH

Sequence 1 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
           WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
Sequence 2 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN

Sequence 1 NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR
           NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR
Sequence 2 NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR

Sequence 1 DRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQ
           DRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQ
Sequence 2 DRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQ

Sequence 1 RPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATK
           RPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATK
Sequence 2 RPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATK

Sequence 1 IALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVII
           IALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVII
Sequence 2 IALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVII

Sequence 1 PAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKEL
           PAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKEL
Sequence 2 PAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKEL

Sequence 1 AFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA
           AFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA
Sequence 2 AFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA



Alignment 2
Sequence 1:
Sequence 2: Allergen Pis v 3.0101, Sequence: EF116865
Sequence identity: 47.35 (277/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------DPELKQCKHQCK-Q-Q---EQKE-
Sequence 2 ------------------------KTDPELKQCKHQCKVQRQYDEEQKEQ

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           C---C--Y---K--------------------------------G-EQ--
Sequence 2 CAKGCEKYYKEK-------------------------------KGREQ--

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDP-EKQYQQCRLQCRRQGEGGG
           -E--EE------EE-----GR-D------P-EK---QC--QC-RQ---GG
Sequence 2 -EEEEE------EEWGSGRGRGDEFSTHEPGEKRLSQCMKQCERQD--GG

Sequence 1 FSREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFE
           -----C--R--EKY--------------E--E--EEQEE------PYVFE
Sequence 2 QQKQLCRFRCQEKYKKERREHSYSRDEEEEEEGDEEQEEEDEN--PYVFE

Sequence 1 DQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPN
           D-HF-T---T--G---VL-KFT-RS-LLRG-E-YR-A-L-A-PQ-F-VPN
Sequence 2 DEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPN

Sequence 1 HWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRD
           H-DA-S--FV--GRGTI---R---RES-N-KQGDI--I-AGT--Y--N-D
Sequence 2 HMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTD

Sequence 1 NNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTR
           -NE-L---KLLQPV--PG--E-F-G-GGENPESF---FS-E-LEAA--T-
Sequence 2 ENEKLYIVKLLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTP

Sequence 1 RDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEG-GIWPFGGESKGTINIY
           RD-L---F--Q--G-IVKAS-EQ-RAMSR--EG--IWPF-G-S-GT-N--
Sequence 2 RDKLEKLFEKQDEGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLF

Sequence 1 QQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKA
           ---P--SN-YGQL-E-----Y--L--LD--VS--NIT-G-M--P-YNS-A
Sequence 2 KKDPSQSNNYGQLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRA

Sequence 1 TKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVV
           TKIA-VV-GEG--E-ACPH-S-S--S--G-----PSY----S------V-
Sequence 2 TKIAIVVSGEGRLEIACPHLSSSKNS--GQEKSGPSYKKLSSSIRTDSVF

Sequence 1 IIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAK
           --PAGHPFV-VAS-NQNL--LCFEVNA--N----LAG--N-----E-EAK
Sequence 2 VVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKEAK

Sequence 1 ELAFGMPAREVEEVSRSQQEEFFFKGP--RQQQQGRADA
           ELAF-----EV--V---Q-EEFFF-GP--RQ-QQGRAD-
Sequence 2 ELAFKTKGEEVDKVFGKQDEEFFFQGPKWRQHQQGRADE



Alignment 3
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 42.22 (247/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           ----------------------------DPE-----C---CR--------
Sequence 2 -----------------------MLPKEDPE--LKKCKHKCRDERQFDEQ

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           -R-------EEK-RE-Q--EG---E---G-E-EE----------PYVF-D
Sequence 2 QRRDGKQICEEKARERQQEEGNSSEESYGKEQEEN---------PYVFQD

Sequence 1 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
           -HF-----T--GR--VL--FT-RS-LL-GIEN-R-AILEA-P-TFI-P-H
Sequence 2 EHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAH

Sequence 1 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
           -DAE-V-FVAKGR-TI--VR---RES-N---GDI--I-AGT--Y-INRD-
Sequence 2 FDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDE

Sequence 1 NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR
           NE-L---K-LQPVS-PG-FE-F-GAGGE-PESF---FS-E-LEAA---RR
Sequence 2 NEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRR

Sequence 1 DRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGG--IWPFGGESKGTINIY
           --L---FG-Q--G-IVKAS-E--RA-S-HEEG---IWPFGGES-G-IN--
Sequence 2 EQLEKVFGEQSKGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLL

Sequence 1 QQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKA
           ---P--SNQ-G-L-E-------QL-DLDL-VS-ANIT-G-M--P-YNS-A
Sequence 2 HKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRA

Sequence 1 TKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVV
           TKI--VV-GEG-FEMACPH-S-S-GSYQ--------------RL-RG-V-
Sequence 2 TKISVVVEGEGFFEMACPHLSSSSGSYQ----------KISARLRRGVVF

Sequence 1 IIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAK
           --PAGHP----AS-N-NLQVLCFEVNA--N--FPLAG--N--N--ER-AK
Sequence 2 VAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAK

Sequence 1 ELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQ--GRADA---
           ELAF--P-REVE-----Q---FFF-GP--QQ---GR------
Sequence 2 ELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRGGRAFE



Alignment 4
Sequence 1:
Sequence 2: Allergen Ana o 1.0102, Sequence: AAM73729
Sequence identity: 45.13 (264/585)
Sequence 1 MSCGGRLCLVLFALLLASAVV-----ASESKDPELKQCKHQCKAQQQISK
           -----------F-L-L-S--V-----A----DPELKQCKHQCK-Q-Q---
Sequence 2 -----PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDE

Sequence 1 EQKEACIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRG
           -QKE-C---C--Y---K--------------------------------G
Sequence 2 QQKEQCVKECEKYYKEK-------------------------------KG

Sequence 1 CEQQHGEQREECLRRCQEEYQREKGRQDDDNPTDP-EKQYQQCRLQCRRQ
           -E--H-E--EE-------------G--D------P-EK---QC--QC-RQ
Sequence 2 REREHEEEEEE----------WGTGGVDEPSTHEPAEKHLSQCMRQCERQ

Sequence 1 GEGGGFSREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRI
           -EGG------C--R--E-Y----G------E--E-----E--EE------
Sequence 2 -EGGQ-QKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEED---EN

Sequence 1 PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQT
           PYVFED--F-T---T--G----L-KFT--S-LL---E-YR-A-L-A-PQ-
Sequence 2 PYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA

Sequence 1 FIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAY
           F-VP-H-DA-S--FV--GRGTI-------RES-N--QGDI--I--GT--Y
Sequence 2 FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFY

Sequence 1 LINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEA
           --N-D-NE-L-L---L-PV--PG-FE-F-G-GGENPESF---FS-EILEA
Sequence 2 IANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEA

Sequence 1 AFNTRRDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGG-IWPFGGESKG
           A--T--D-L---F--Q-QG-I-KAS-EQVRAMSR--EG--IWPF--ES-G
Sequence 2 ALKTSKDTLEKLFEKQDQGTIMKASKEQVRAMSRRGEGPKIWPFTEESTG

Sequence 1 TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPH
           --------P--SN-YGQL-E-----Y--L--LD--VS-ANIT-G-M--P-
Sequence 2 SFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPF

Sequence 1 YNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLT
           YNS-ATKIA-VV-GEG--E-ACPH-S-S--S--------PSY-----R--
Sequence 2 YNSRATKIAIVVSGEGCVEIACPHLSSSKSSH-------PSYKKLRARIR

Sequence 1 RGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQL
           --TV-I-PAGHPF--VAS-N-NL---CFEVNA--N----LAG--N-----
Sequence 2 KDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVM

Sequence 1 EREAKELAFGMPAREVEEVSRSQQEEFFFKGP--RQQQQGRADA
           E-EAKELAF-M---EV--V---Q-EEFFF-GP--R----GRAD-
Sequence 2 EKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE



Alignment 5
Sequence 1:
Sequence 2: Allergen Ana o 1.0101, Sequence: AAM73730
Sequence identity: 45.13 (264/585)
Sequence 1 MSCGGRLCLVLFALLLASAVV-----ASESKDPELKQCKHQCKAQQQISK
           ----G------F-L-L-S--V-----A----DPELKQCKHQCK-Q-Q---
Sequence 2 ---MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDE

Sequence 1 EQKEACIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRG
           -QKE-C---C--Y---K--------------------------------G
Sequence 2 QQKEQCVKECEKYYKEK-------------------------------KG

Sequence 1 CEQQHGEQREECLRRCQEEYQREKGRQDDDNPTDP-EKQYQQCRLQCRRQ
           -E--H-E--EE-------------G--D------P-EK---QC--QC-RQ
Sequence 2 REREHEEEEEE----------WGTGGVDEPSTHEPAEKHLSQCMRQCERQ

Sequence 1 GEGGGFSREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRI
           -EGG------C--R--E-Y----G------E--E-----E--EE------
Sequence 2 -EGGQ-QKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEED---EN

Sequence 1 PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQT
           PYVFED--F-T---T--G----L-KFT--S-LL---E-YR-A-L-A-PQ-
Sequence 2 PYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA

Sequence 1 FIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAY
           F-VP-H-DA-S--FV--GRGTI-------RES-N--QGDI--I--GT--Y
Sequence 2 FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFY

Sequence 1 LINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEA
           --N-D-NE-L-L---L-PV--PG-FE-F-G-GGENPESF---FS-EILEA
Sequence 2 IANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEA

Sequence 1 AFNTRRDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGG-IWPFGGESKG
           A--T--D-L---F--Q-QG-I-KAS-EQ-RAMSR--EG--IWPF--ES-G
Sequence 2 ALKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTG

Sequence 1 TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPH
           --------P--SN-YGQL-E-----Y--L--LD--VS-ANIT-G-M--P-
Sequence 2 SFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPF

Sequence 1 YNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLT
           YNS-ATKIA-VV-GEG--E-ACPH-S-S--S--------PSY-----R--
Sequence 2 YNSRATKIAIVVSGEGCVEIACPHLSSSKSSH-------PSYKKLRARIR

Sequence 1 RGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQL
           --TV-I-PAGHPF--VAS-N-NL---CFEVNA--N----LAG--N-----
Sequence 2 KDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVM

Sequence 1 EREAKELAFGMPAREVEEVSRSQQEEFFFKGP--RQQQQGRADA
           E-EAKELAF-M---EV--V---Q-EEFFF-GP--R----GRAD-
Sequence 2 EKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE



Alignment 6
Sequence 1:
Sequence 2: Allergen Mac i 1.0201, Sequence: Q9SPL4
Sequence identity: 42.05 (246/585)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSG

Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPEL--KQCKHQCKAQQQISKEQK
           --------------------------DP-----QC---C--QQ-----Q-
Sequence 2 QMRRCVSQCDKRFEEDIDWSKYDNQDDPQTDCQQCQRRCR-QQESGPRQQ

Sequence 1 EACIQACKEYIRQKHQGEHGRGGGDILEEEVWNR-KSPIERLRECSRGCE
           --C---CKE------------------EEE--NR---P------C---C-
Sequence 2 QYCQRRCKEICE---------------EEEEYNRQRDPQQQYEQCQERCQ

Sequence 1 QQHGEQR--EECLRRCQEEYQREKGRQ--------------------DDD
           ----E-R----C--RC---Y--EK--Q----------------------D
Sequence 2 RHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEED

Sequence 1 NPTDPE-KQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGR-
           N--DP----Y--CR--C--Q----------C-RR--E--R-Q-GR-G---
Sequence 2 NKRDPQQREYEDCRRRCEQQEPRQQY---QCQRRCREQQR-QHGRGGDLI

Sequence 1 GEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDR
           -----G--R-EE-EE------PY-F------T-FRT--G---VL--F--R
Sequence 2 NPQRGGSGRYEEGEEK-QSDNPYYFDERSLSTRFRTEEGHISVLENFYGR

Sequence 1 SELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDR
           S-LLR---NYR---LEA-P--F--P-H-DA-----V--GRG-------D-
Sequence 2 SKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDN

Sequence 1 RESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPGEFELFF
           RES-N---GD---I-AGTT-YLINRDNNERL--AK-LQ--STPG----FF
Sequence 2 RESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFF

Sequence 1 GAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQQRQGVIVKASEEQV
           -AGG-NPE-----FS-EILEAA-NT---RL----GQQR-GVI--AS-EQ-
Sequence 2 PAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGVIISASQEQI

Sequence 1 RAMSRHE-EGGIWPF--GGES-KGTINIYQQRPTHSNQYGQLHEVDASQY
           R---R---E---W----GGES--G--N----RP--SN-YGQ--EV----Y
Sequence 2 RELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDY

Sequence 1 RQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMS
           RQL-D-D--V--ANITQG-M--P--N---TK---V--GE---EMACPH-S
Sequence 2 RQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS

Sequence 1 RSRGSYQGETRGRPS----YQRVASRLTRGTVVIIPAGHPFVAVASSNQN
           ---G---G--R--------Y--V--RL--------P-GHP-V-V-S-N-N
Sequence 2 GRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNEN

Sequence 1 LQVLCFEVNANNNEKFPLAGR-RNVMNQLEREAKELAFGMPAREVEEVSR
           L----F--NA-NN----LAGR-RNV--Q-E--A-ELAF--P--EVEE---
Sequence 2 LLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFN

Sequence 1 SQQEEFFFKGPRQQQQGRADA----------------
           SQ-E--FF-GPRQ-QQ---------------------
Sequence 2 SQDESIFFPGPRQHQQQSSRSTKQQQPLVSILDFVGF



Alignment 7
Sequence 1:
Sequence 2: Allergen Mac i 1.0101, Sequence: Q9SPL3
Sequence identity: 42.05 (246/585)
Sequence 1 ---------MSCGGRLCLVLFALLLASAVVASESKDP--ELKQCKHQCKA
           -----------------------------------DP--E--QC---C--
Sequence 2 QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQEDPQTECQQCQRRCR-

Sequence 1 QQQISKEQKEACIQACKEYIRQKHQGEHGRGGGDILEEEVWNR-KSPIER
           QQ-----Q---C---CKE------------------EEE--NR---P---
Sequence 2 QQESDPRQQQYCQRRCKEICE---------------EEEEYNRQRDPQQQ

Sequence 1 LRECSRGCEQQHGEQREE--CLRRCQEEYQREKGRQ--------------
           ---C---C-----E-R----C--RC---Y--EK--Q--------------
Sequence 2 YEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQKRYEEQQREDEEK

Sequence 1 ------DDDNPTDPE-KQYQQCRLQCRRQGEGGGFSREHCERRREEKYRE
           --------DN--DP----Y--CR--C--Q----------C-RR--E--R-
Sequence 2 YEERMKEGDNKRDPQQREYEDCRRHCEQQEPRLQY---QCQRRCQEQQR-

Sequence 1 QQGREGG-RGEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRM
           Q-GR-G--------G--R-EE-EE------PY-F------T-FRT--G--
Sequence 2 QHGRGGDLMNPQRGGSGRYEEGEEK-QSDNPYYFDERSLSTRFRTEEGHI

Sequence 1 RVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRG
           -VL--F--RS-LLR---NYR---LEA-P--F--P-H-DA-----V--GRG
Sequence 2 SVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRG

Sequence 1 TISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVS
           -------D-RES-N---GD---I-AGTT-YLINRDNNERL--AK-LQ--S
Sequence 2 ALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTIS

Sequence 1 TPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQQRQGV
           TPG----FF-AGG-NPE-----FS-EILEAA-NT---RL----GQQR-GV
Sequence 2 TPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVLGQQREGV

Sequence 1 IVKASEEQVRAMSRHE-EGGIWPF--GGES-KGTINIYQQRPTHSNQYGQ
           I--AS-EQ-R---R---E---W----GGES--G--N----RP--SN-YGQ
Sequence 2 IIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQ

Sequence 1 LHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGY
           --EV----YRQL-D-D--V--ANITQG-M--P--N---TK---V--GE--
Sequence 2 AYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEAD

Sequence 1 FEMACPHMSRSRGSYQGETRGRPS----YQRVASRLTRGTVVIIPAGHPF
           -EMACPH-S---G---G--R--------Y--V--RL---------AGHP-
Sequence 2 VEMACPHLSGRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPV

Sequence 1 VAVASSNQNLQVLCFEVNANNNEKFPLAGR-RNVMNQLEREAKELAFGMP
           V-V-S-N-NL----F--NA-NN----LAGR-RNV--Q-E--A-ELAF---
Sequence 2 VFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAS

Sequence 1 AREVEEVSRSQQEEFFFKGPRQQQQGRADA----------------
           --EVEE---SQ-E--FF-GPRQ-QQ---------------------
Sequence 2 RKEVEELFNSQDESIFFPGPRQHQQQSPRSTKQQQPLVSILDFVGF



Alignment 8
Sequence 1:
Sequence 2: Allergen Jug r 6.0101, Sequence: A0A2I4E5L6
Sequence identity: 45.81 (268/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 -------------------------------------------------M

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           ----------------------------DPE----QC--QCR-Q------
Sequence 2 AFKPKIPIALLLLTSLLAICAGLALAMQDPE--LKQCKHQCRHQRQFDEQ

Sequence 1 SREHCERRREEKYREQQGRE-GGRGEMYEGREREE--EQEEQGRGR---I
           --EHC-R---E---E---RE---R----EG--REE--E-EE-G--R----
Sequence 2 EKEHCQRSCDEYHIEKKARERAERRRSEEGSSREEGYEEEELGGEREEEN

Sequence 1 PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQT
           PYVFED--F-T--RT--GR--VL-KFT-RS-LLRGIEN-RVAILEA-PQT
Sequence 2 PYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQT

Sequence 1 FIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAY
           FI-P-H-DAE-VVFVAKGR-TI--VR---RE--N--QGDI--I-AGT--Y
Sequence 2 FISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVY

Sequence 1 LINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEA
           LINRD-NE-L---K-L-PVS-PG-FE-F-G-GGE-PESF---FS-E-LEA
Sequence 2 LINRDENEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEA

Sequence 1 AFNTRRDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGG--IWPFGGESK
           A--TRRD-L---FG-Q-QGVI-KAS-EQ-R-MS-HEE----IWPFGG-S-
Sequence 2 ALKTRRDQLEKLFGKQTQGVIIKASKEQIRSMSKHEETTPRIWPFGGDST

Sequence 1 GTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAP
           ---N----RP--SNQ-G-L-E-D-----QL-DLDL-VS-ANIT-G-M--P
Sequence 2 HPFNLFHKRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGP

Sequence 1 HYNSKATKIALVVDGEGYFEMACPHMSRS--RGSYQG------ETRGRPS
           -YNS-ATKI--V--GEGYFEMACPH-S-S--RG---G--------R--PS
Sequence 2 YYNSRATKISVVIEGEGYFEMACPHLSSSGSRGQREGSGSSRRRSRSGPS

Sequence 1 YQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLA
           YQ----RL--G-V---PAGHP----AS-N-NLQVLCF-VNA--N--FPLA
Sequence 2 YQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDVNAQGNIRFPLA

Sequence 1 GRRNVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQ--GR
           G--N--N--E-EAKELAF--PAREVE---R-Q--EFFF-GP--Q----GR
Sequence 2 GKNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQPEEGGR

Sequence 1 ADA
           A--
Sequence 2 AFE



Alignment 9
Sequence 1:
Sequence 2: Allergen Car i 2.0101, Sequence: B3STU4
Sequence identity: 43.08 (252/585)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRD

Sequence 1 --------------------------------MSCGGRLCLVLFALLLAS
           -------------------------------------R------------
Sequence 2 PREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRD

Sequence 1 AVVASESKDP--ELKQCKHQCKAQQQISKEQKEACIQACKEYI--RQKHQ
           --------DP-----QC---C--Q-Q----Q---C---C-E-----Q--Q
Sequence 2 NDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQ-CQSRCEERLEEEQRKQ

Sequence 1 GEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH-GEQREECLRRC-Q
           -E--R--G----E---N---P--R---C---CE-Q--G-----C-RRC-Q
Sequence 2 EERERRRGR--DEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQ

Sequence 1 EEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGFSREHCERRREEK
           ---Q-E--RQ------DP--QY--C---C--Q-------R--C--R-E--
Sequence 2 QRQQEERERQRGRDRQDPQQQYHRCQRRCQTQEQSPERQRQ-CQQRCERQ

Sequence 1 YREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHG
           Y-EQQGRE-G-------RE-----EEQ-R---PY-F--Q----------G
Sequence 2 YKEQQGREWGPDQASPRRESRGREEEQQRHN-PYYFHSQGLRSRHESGEG

Sequence 1 RMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKG
           ----L--FT-R-ELLRGIENYRV-ILEA-P-TF--P-H-DAESV--V--G
Sequence 2 EVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRG

Sequence 1 RGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQP
           R-T---V-Q-RRES-N---GD-----AG-T-Y-IN-D-NERL---KLLQP
Sequence 2 RATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQP

Sequence 1 VSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQ--Q
           V--PG-F-----AG----ES----FS--IL-AA-NT-RDRL-R-F-Q--Q
Sequence 2 VNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQ

Sequence 1 RQGVIVKASEEQVRAMSRHE-EGGIWPFGGESKG-TINIYQQRPTHSNQY
           R-GVI--AS-E--RA-S-H----G--P-G--S-G--I----QR---SNQ-
Sequence 2 REGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQF

Sequence 1 GQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGE
           GQ--E------RQL---D--V--A-I--GAM--PHYNSKAT----VV-G-
Sequence 2 GQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGT

Sequence 1 GYFEMACPH-MSRSRGSYQG------ETRGRPSYQRVASRLTRGTVVIIP
           G-FEMACPH--S-----Y-G------E-------Q-V--RL-RG----IP
Sequence 2 GRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIP

Sequence 1 AGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKELA
           AGHP----AS-N-NL----F--N--NN----LAG--N--NQLEREAKEL-
Sequence 2 AGHPIAITASQNENLRLVGFGINGKNNQRNFLAGQNNIINQLEREAKELS

Sequence 1 FGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA-------------
           F-MP--E-EE----Q-E--F----RQ---G-----------------
Sequence 2 FNMPREEIEEIFERQVESYFVPMERQSRRGQGRDHPLASILDFAGFF



Alignment 10
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 42.91 (251/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDP--ELKQCKHQCKAQQQISKEQK
           --------------------------DP-----QC---C--Q-Q----Q-
Sequence 2 --------------RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQ

Sequence 1 EACIQACKEYIR--QKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGC
           --C---C-E-----Q--Q-E--R--G--------N---P--R---C---C
Sequence 2 Q-CQIRCEERLEEDQRSQEERERRRGRDVDDQ--NPRDPEQRYEQCQQQC

Sequence 1 E-QQHGEQREECLRRC-QEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQ
           E-Q--G-----C-RRC-Q---Q-E--RQ------DP--QY--C---C--Q
Sequence 2 ERQRRGQEQTLCRRRCEQRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQ

Sequence 1 GEGGGFSREHCERRREEKYREQQGREGG--RGEMYEGREREEEQEEQGRG
           -------R--C--R-E--Y-EQQGRE-G-------E-R-REEEQ------
Sequence 2 EQSPERQRQ-CQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHN--

Sequence 1 RIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEP
           --PY-F--Q----------G----L--FT-R-ELLRGIENYRV-IL-A-P
Sequence 2 --PYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANP

Sequence 1 QTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTT
           -T---P-H-DAESV--V--GR-T--LV-Q--RES-N---GD-----AG-T
Sequence 2 NTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGAT

Sequence 1 AYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPE-SFFKSFSDEI
           -Y-IN-D-NERL---KLLQPV--PG-F-----AG---P--S----FS--I
Sequence 2 VYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDI

Sequence 1 LEAAFNTRRDRLQRIFGQQ--RQGVIVKASEEQVRAMSRHE-EGGIWPFG
           L-AA-NT-RDRL-R-F-QQ--R-GVI--AS-E--RA-S-H----G--P-G
Sequence 2 LVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWG

Sequence 1 GESKG-TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQG
           --S-G--I------P--SNQ-GQ--E------RQL---D--V--A-I--G
Sequence 2 RRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRG

Sequence 1 AMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQG-------ETR
           AM--PHYNSKAT----VV-G-G--EMACPH-S------QG-------E--
Sequence 2 AMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEEST

Sequence 1 GRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEK
           GR---Q-V--RL-RG----IPAGHP----AS-N-NL--L-F--N--NN--
Sequence 2 GR--FQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQR

Sequence 1 FPLAGRRNVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQ
           --LAG--N--NQLEREAKEL-F-MP--E-EE---SQ-E--F----RQ---
Sequence 2 DFLAGQNNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR

Sequence 1 GRADA------------
           G----------------
Sequence 2 GQGRDHPLASILDFAFF



Alignment 11
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 37.09 (217/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           ----------------------------DP--QY--C---C--Q------
Sequence 2 -----------------------GRDRQDPQQQYHRCQRRCQIQEQSPER

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           -R--C--R-E--Y-EQQGRE-G--E----RE-----EEQ-R---PY-F--
Sequence 2 QRQ-CQQRCERQYKEQQGRERG-PEASPRRESKGREEEQQRHN-PYYFHS

Sequence 1 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
           Q----------G----L--F--R-ELLRGIENYRV-IL-A-P-TF--P-H
Sequence 2 QSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPHH

Sequence 1 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
           -DAESV--V--GR-T--LV-Q--RES-N---GD-----AG-T-Y-IN-D-
Sequence 2 KDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDS

Sequence 1 NERLVLAKLLQPVSTPGEFELFFGAGGENPE-SFFKSFSDEILEAAFNTR
           NERL---KLLQPV--PG-------AG---P--S----FS--IL-AA-NT-
Sequence 2 NERLEMVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTP

Sequence 1 RDRLQRIFGQQ--RQGVIVKASEEQVRAMSRHE-EGGIWPFGGESKG-TI
           RDRL-R-F-QQ--R-GVI--AS-E--RA-S-H----G--P-G--S-G--I
Sequence 2 RDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPI

Sequence 1 NIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYN
           -----RP--SNQ-GQ--E------RQL---D--V--A-I--GAM--PHYN
Sequence 2 SLKSERPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYN

Sequence 1 SKATKIALVVDGEGYFEMACPHMSRSRGSYQG-------ETRGRPSYQRV
           SKAT----VV-G-G--EMACPH-S------QG-------E--GR---Q-V
Sequence 2 SKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEEESTGR--FQKV

Sequence 1 ASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRN
           --RL-RG----IPAGHP----AS-N-NL--L-F--N--NN----LAG---
Sequence 2 TARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNFLAGQNS

Sequence 1 VMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA---
           --NQLEREAKEL-F-MP--E-EE---SQ-E--F----RQ---G-------
Sequence 2 IINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPL

Sequence 1 ---------
           ---------
Sequence 2 ASILGFAFF



Alignment 12
Sequence 1:
Sequence 2: Allergen Pin k 2.0101, Sequence: V9VGU0
Sequence identity: 29.74 (174/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 ------------------------------MAFVSLLTILLAISSSSVAL

Sequence 1 SREHCERRREEKYREQQGR--------EGGRGEMYEGREREEEQEEQGRG
           --------------EQ-GR--------E-GRG----GRE--EE-EE----
Sequence 2 TEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGRE--EEREEN---

Sequence 1 RIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEP
           --PYVF----F--------G--R-L--F---SELL-GI--YRV---E--P
Sequence 2 --PYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKP

Sequence 1 QTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTT
           -T---P---DA-----V--GRG-I--V-Q----------GD------G-T
Sequence 2 NTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHT

Sequence 1 AYLINRDNNERLVLAKLLQPVSTP-GEFELFFGAGGENPESFFKSFSDEI
           -YL-N-D----L--A-LL---ST--GE-E-F--AGG-NPE-----FSD--
Sequence 2 FYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDV

Sequence 1 LEAAFNTRRDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGES
           LEAAFNT----L--IFG--R-GVI--A-EEQ-R-M-R---GG---F--ES
Sequence 2 LEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRR--GG---FSAES

Sequence 1 KGT------INIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANIT
           ----------N---Q-P---N--G------------L---D-TV------
Sequence 2 TSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLN

Sequence 1 QGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRP--
           -G-MTAP--N-KAT-IA-V--GEG--EMACPH-----G------RG----
Sequence 2 PGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDI

Sequence 1 SYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPL
           -Y-RV--RL--GTV---PAGHP----AS-N--L--L-F--N---NE---L
Sequence 2 NYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFL

Sequence 1 AGRRNVMNQLEREAKELAFGMP-AREVEEVSRSQQEEFFFKGPRQQQQGR
           AG--NV---LE-E---L-F--P---E-EEV---Q-------GP--Q----
Sequence 2 AGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDE

Sequence 1 ADA--
           -----
Sequence 2 PRSSS



Alignment 13
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB23463
Sequence identity: 24.10 (141/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           --------------------------------------------P--F--
Sequence 2 ------------MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRS

Sequence 1 QH-FITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPN
           ---F-T-F--Q--R-R-LQ-F--RS--L-----YR-------P-T---P-
Sequence 2 SNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPH

Sequence 1 HWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRD
           H-DA----FV--GR----LV--D-R-S-N---GD---I-AGTT-YL-N--
Sequence 2 HADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPH

Sequence 1 NNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTR
           ----L---KL--PV--PG----FF--------S----FS--ILE--F---
Sequence 2 DHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSE

Sequence 1 RDRLQRI-FGQ---QRQ--GVIVKASEEQVRAMSRHEEGGIWPFGGESKG
           -----R--FG----QRQ--GVIV--S-EQ-R--SR---------------
Sequence 2 FEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDE

Sequence 1 TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPH
           --N-----P--SN--G---E-------QLRDLD---S---I--GA---PH
Sequence 2 PFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPH

Sequence 1 YNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLT
           -NSKA--I-----G----E---------------E-------QR----L-
Sequence 2 FNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPL---EVQRYRAELS

Sequence 1 RGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQ
           ---V--IPA--PFV--A-SN-N---L-F--NA-NN----LAG---NV--Q
Sequence 2 EDDVFVIPAAYPFVVNATSNLNF--LAFGINAENNQRNFLAGEKDNVVRQ

Sequence 1 LEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQGRADA------
           -ER---ELAF---A--VE-----Q-E--F----P-Q---G----------
Sequence 2 IERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPS

Sequence 1 ------
           ------
Sequence 2 ILGALY



Alignment 14
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 29.06 (170/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           ---------------------------------------------E--E-
Sequence 2 --------------------------------------------VEEEEE

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEE-VWNRKSPIERLRECSRGCEQQ
           C--------R--H--------G---E-E----R--P--R-R------E--
Sequence 2 CEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQ--EEE

Sequence 1 HGEQREECLRRCQEEYQREKGRQDDDN------PTDP-EKQYQQCRLQCR
           H-EQ-EE------EE----KG------------P--P--K-------Q--
Sequence 2 H-EQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHK

Sequence 1 RQGEGGGFSREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRG
           -----G--S-E--E---E---------E-------EG-E---E-------
Sequence 2 QEKHQGKESEEEEEDQDEDEEQDKESQES------EGSESQREPRRH-KN

Sequence 1 RIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEP
           --P--F----F-T-F--Q-G--RVLQ-F--RS--L-----YR-------P
Sequence 2 KNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKP

Sequence 1 QTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTT
           -T---P-H-DA--------G-----LV--D-R-S-N---GD-L---AGTT
Sequence 2 NTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTT

Sequence 1 AYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEIL
           -Y--N-DN-E-L----L--PV--PG-FE-FF--------S----FS--IL
Sequence 2 YYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNIL

Sequence 1 EAAFNTRRDRLQRI-FGQ---QRQG-------VIVKASEEQVRAMSRHEE
           EA---T---------FG----Q-QG-------VIV--S--Q-R--S-H--
Sequence 2 EASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAK

Sequence 1 GGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSL
           --------------N-----P--SN--G-L-E-------QLRDLD---S-
Sequence 2 SSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSV

Sequence 1 ANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRG
           -----GA---PH-NSKA--------GE---E---------R---Q-----
Sequence 2 VDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQR---QQQEEQ

Sequence 1 RPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKF
           ----------L-------IPAG-P-V--A-S--N-----F--NA-NN---
Sequence 2 PLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNF--FAFGINAENNQRN

Sequence 1 PLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQ
           -LAG---NV--Q------ELAF---A---E----SQ-E--F----P-Q--
Sequence 2 FLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE

Sequence 1 QGRADA------------
           -G----------------
Sequence 2 EGNKGRKGPLSSILRAFY



Alignment 15
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 32.65 (191/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVAS------ESKDPELKQC-----------
           -----R--L-L--L-----V--S------E---P----C-----------
Sequence 2 -MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSY

Sequence 1 KHQ-CKAQQQISKEQKEACIQAC--KEYIRQKHQGEHGRGGGDILEEEVW
           --Q-C-A-----K--KE-C----------R--H--------G---E-E--
Sequence 2 RNQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDED-

Sequence 1 NRKSPIERLRECSRGCEQQHGEQREECLRRCQEEYQREKGRQDDDNPTDP
           ----PI---R---R--E--H-EQREE------EE---EKG----D---D-
Sequence 2 EQPRPIPFPRPQPRQ-EEEH-EQREEQEWPRKEEKRGEKGSEEEDEDEDE

Sequence 1 EKQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGRGEMYEGR
           E----Q------R------------ER--EE---E-Q-RE----------
Sequence 2 EQDERQFPFP--RP------PHQKEERNEEEDEDEEQQRES--------E

Sequence 1 EREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGI
           E-E-----------P--F----F-T-F--Q-GR-RVLQ-F--RS--L---
Sequence 2 ESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNL

Sequence 1 ENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIK
           --YR-------P-T---PNH-DA--------G----SLV--D-R-S----
Sequence 2 RDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQ

Sequence 1 QGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENP
           -GD-L----GTT-Y--N-DNNE-L-L--L--PV--PG-FE-FF----E--
Sequence 2 SGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQ

Sequence 1 ESFFKSFSDEILEAAFNTRRDRLQRIF---------GQQR--QGVIVKAS
           -S----FS--ILEA---T------------------G-QR----VIV--S
Sequence 2 QSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEIS

Sequence 1 EEQVRAMS-RHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQ
           -EQ-RA-S-R-----------E-K---N-----P--SN--G---E-----
Sequence 2 KEQIRALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFFEITPEK

Sequence 1 YRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHM
           --QLRDLD---S------GA---PH-NSKA--I-----G----E------
Sequence 2 NPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV--GL

Sequence 1 SRSRGSYQGETRGRP-SYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQ
           -------Q-E----P---------L-------IPAG-P-V--A-SN-N--
Sequence 2 KEQQQEQQQEEQ--PLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF-

Sequence 1 VLCFEVNANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQ
           ------NA-NN----LAG---NV--Q------ELAF---A--VE-----Q
Sequence 2 -FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQ

Sequence 1 QEEFFFKG-PRQQQQGRADA------------
           -E--F----P-----G----------------
Sequence 2 RESYFVDAQPKKKEEGNKGRKGPLSSILRAFY



Alignment 16
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 30.43 (178/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           -----------------------------------------------KE-
Sequence 2 ---------------------------------------------VEKEE

Sequence 1 CIQAC--KEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQ
           C----------R--H--------G---E-E------PI---R---R--E-
Sequence 2 CEEGEIPRPRPRPQHPEREPQQPGEKEEDED-EQPRPIPFPRPQPRQ-EE

Sequence 1 QHGEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGG
           -H-EQREE------EE---EKG----D---D-E----Q------R-----
Sequence 2 EH-EQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFP--RP----

Sequence 1 GFSREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVF
           -------ER--EE---E-Q-RE----------E-E-----------P--F
Sequence 2 --PHQKEERKQEEDEDEEQQRES--------EESEDSELRRHKNKNPFLF

Sequence 1 EDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVP
           ----F-T-F--Q-GR-RVLQ-F--RS--L-----YR-------P-T---P
Sequence 2 GSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP

Sequence 1 NHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINR
           NH-DA--------G----SLV--D-R-S-----GD-L----GTT-Y--N-
Sequence 2 NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNP

Sequence 1 DNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNT
           DNNE-L-L--L--PV--PG-FE-FF----E---S----FS--ILEA---T
Sequence 2 DNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDT

Sequence 1 RRDRLQRIF---------GQQR--QGVIVKASEEQVRAMS-RHEEGGIWP
           ------------------G-QR----VIV--S-EQ-RA-S-R--------
Sequence 2 KFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKT

Sequence 1 FGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQ
           ---E-K---N-----P--SN--G---E-------QLRDLD---S------
Sequence 2 ISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNE

Sequence 1 GAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRP-SY
           GA---PH-NSKA--I-----G----E-------------Q-E----P---
Sequence 2 GALLLPHFNSKAIVILVINEGDANIELV--GLKEQQQEQQQEEQ--PLEV

Sequence 1 QRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAG
           ------L-------IPAG-P-V--A-SN-N--------NA-NN----LAG
Sequence 2 RKYRAELSEQDIFVIPAGYPVVVNATSNLNF--FAIGINAENNQRNFLAG

Sequence 1 RR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQGRA
           ---NV--Q------ELAF---A--VE-----Q-E--F----P-----G--
Sequence 2 SQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNK

Sequence 1 DA------------
           --------------
Sequence 2 GRKGPLSSILRAFY



Alignment 17
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 35.56 (208/585)
Sequence 1 -------MSCGGRLCLVLFALLLASAVVASESKD----PELKQCKHQCKA
           -------------L--V-F-LL-AS---A---KD----P-----------
Sequence 2 MAKMRVRLPMLILLLGVVF-LLAASIGIAYGEKDFTKNPPKEREEEEHEP

Sequence 1 QQQISKEQKEACIQACKEYIRQ-KHQGE--HGRGGGDILEEEVWNRKSPI
           -QQ----Q-E-------E--R--KH-GE---GR-------EE---R----
Sequence 2 RQQPRPRQQE---EQEREHRREEKHDGEPSRGRSQSEESQEEEHERRREH

Sequence 1 ERLRECSRGCEQQHGEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQ
           -R-RE-----EQQ---QR--------EE-Q----R---------E----Q
Sequence 2 HREREQ----EQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQ

Sequence 1 CRLQCRRQGEGGGFSREHCERR--REEKYREQQGREGGRGEMYEGREREE
           --------G-GG---R-H-ERR--REE---EQ--R---R-----------
Sequence 2 GSSSGSQRG-GGDERRQHRERRVHREEREQEQDSRSDSR-----------

Sequence 1 EQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYR
           ------R-R-PY-F----F-T--R---G--RVL--F--R---L----NYR
Sequence 2 ------RQRNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYR

Sequence 1 VAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDI
           -------P-T-I-P-H-DA-----V--GR-TI--V--D-R---N--QGD-
Sequence 2 IIEFQSKPNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDA

Sequence 1 LKINAGTTAYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFF
           L---AGTT-Y--N-D-N--L--AKL--P---PG----F---------S-F
Sequence 2 LRLPAGTTSYILNPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKDQQSYF

Sequence 1 KSFSDEILEAAFNTRRDRLQRIF--------------GQ----QRQGVIV
           --FS---LEA-FNTR-----R----------------GQ----Q--GVIV
Sequence 2 SGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRRGQEQSHQDEGVIV

Sequence 1 KASEEQVRAMSRHEEGGIWPFGGESK----GTINIYQQRPTHSNQYGQLH
           --S--Q------H---------GE-K----G--N-----P--SN--G---
Sequence 2 RVSKKQIQELRKHAQSS----SGEGKPSESGPFNLRSNKPIYSNKFGNFY

Sequence 1 EVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFE
           E-------Q--DL--------I--GA---PHYNSKA--I--V--GEG--E
Sequence 2 EITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYE

Sequence 1 MACPHMSRSRGSYQGET--RGRPSYQRVASRLTRGTVVIIPAGHPFVAVA
           -------------Q-E----G-----R----L--G-V-IIPAGHP----A
Sequence 2 LVGIRDQQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINA

Sequence 1 SSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREV
           SSN--L--L-F--NAN-N----LAG---NV--QL-RE-KEL-F------V
Sequence 2 SSN--LRLLGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDV

Sequence 1 EEVSRSQQEEFFFKGPRQQQQGRADA-----------------
           E-----QQ---F-----QQQQ-R--------------------
Sequence 2 ERLIKNQQQSYFANAQPQQQQQREKEGRRGRRGPISSILNALY



Alignment 18
Sequence 1:
Sequence 2: Allergen Vig r 2.0101, Sequence: Q198W3
Sequence identity: 24.79 (145/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQ-GRGRI-PYVF
           -------R---------------------RE--E-QEE---RG---P--F
Sequence 2 ---MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYF

Sequence 1 E-DQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIV
           --D--F-T-F--Q-G--RV---F--RS------ENYRV------P-T---
Sequence 2 NSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLL

Sequence 1 PNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLIN
           P-H-DA-----V--GR----LV--D-R-S----QG---KI-AGTT--L-N
Sequence 2 PHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN

Sequence 1 RDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFN
           ---N--L---KL--PV--P--F--FF----E---S----FS--ILEA-F-
Sequence 2 PNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFD

Sequence 1 TRRDRLQRI-FGQQRQ----------GVIVKASEEQVRAMSRHEEGGIWP
           -------R--FG--RQ----------GVIV----EQ-R----H-------
Sequence 2 SDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRK

Sequence 1 FGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQ
           ---------N-----P--SN--G---E-------QL-DLD---S------
Sequence 2 ELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKE

Sequence 1 GAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQ
           G----PHYNSKA--I-----GE---E---P----S----Q-E-------Q
Sequence 2 GGLLLPHYNSKAIVILVINEGEAKIELVGP----SDQQQQDESL---EVQ

Sequence 1 RVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGR
           R----L----V--IPA--P----A-SN-N-----F--NA-NN----LAG-
Sequence 2 RYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGE

Sequence 1 R-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQGRAD
           --NVM-----E-----F------VE-----Q-E--F----P-QQQ-----
Sequence 2 KDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGH

Sequence 1 A--------------
           ---------------
Sequence 2 KGRKGSLSSILGSLY



Alignment 19
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43238
Sequence identity: 33.50 (196/585)
Sequence 1 -MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKE
           -------L-L-L--L-LAS---------P--K-----C-AQ---------
Sequence 2 MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPC-AQR--------

Sequence 1 ACIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQ
           -C-Q-C-----------------D--------R----E----C-------
Sequence 2 -CLQSCQQE------------PDDLKQKACESRCTKLEYDPRCVYDPRGH

Sequence 1 HGEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGG
           -G---------------R--GRQ--D---D-----Q--R----R-G--G-
Sequence 2 TGTTNQR-----SPPGERTRGRQPGDYDDD---RRQPRREEGGRWGPAGP

Sequence 1 FSREHCE--RRREEKYRE---QQGR----EGGRGEMYEGREREEEQEEQG
           --RE--E--R---E--R----QQ-R----EG--GE---G-------EE--
Sequence 2 REREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSHVREETS

Sequence 1 RGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEA
           R---P--F----F-T----Q-GR-RVLQ-F--RS-------N-R----EA
Sequence 2 RNN-PFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEA

Sequence 1 EPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAG
           -P-T---P-H-DA--------G--T--------R-S-N---G--L-I--G
Sequence 2 KPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSG

Sequence 1 TTAYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDE
           ---Y--NR--N--L--AK---PV-TPG-FE-FF-A------S----FS--
Sequence 2 FISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRN

Sequence 1 ILEAAFNTRRDRLQRIF------------GQQR---------QGVIVKAS
           -LEAAFN-------R--------------GQ-R----------GVIVK-S
Sequence 2 TLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSENNEGVIVKVS

Sequence 1 EEQVRAMSRHEEGGIWPFGGESKGTI----NIYQQRPTHSNQYGQLHEVD
           -E-V-----H--------G-E--G-I----N-----P--SN--G-L-EV-
Sequence 2 KEHVEELTKHAKS-VSKKGSEEEGDITNPINLREGEPDLSNNFGKLFEVK

Sequence 1 ASQYR-QLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEM-
           ------QL-DLD-------I--GA---PH-NSKA--I--V--G-G--E--
Sequence 2 PDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELV

Sequence 1 ACPHMSRSRGSYQGET------RGRPS-YQRVASRLTRGTVVIIPAGHPF
           A-------RG----E--------G------R---RL--G-V-I-PA-HP-
Sequence 2 AVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHP-

Sequence 1 VAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQLEREAKELAFGMP
           VA---S---L--L-F--NA-NN----LAG---NV--Q-E--AK-LAF---
Sequence 2 VAINASSE-LHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGS

Sequence 1 AREVEEVSRSQQEEFFFKG-PRQQQQGRADA-------------------
           ---VE-----Q-E--F----P--Q-Q------------------------
Sequence 2 GEQVEKLIKNQKESHFVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKG

Sequence 1 ----------
           ----------
Sequence 2 PLLSILKAFN



Alignment 20
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43237
Sequence identity: 31.97 (187/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------G----------------RK--------C---C-Q--
Sequence 2 --MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEP

Sequence 1 GEQREE-CLRRCQE-EYQ----REKGRQDDDNPTDPE---KQ---YQQCR
           -------C--RC---EY--------G------P--------Q---Y---R
Sequence 2 DDLKQKACESRCTKLEYDPRCVYDTGATNQRHPPGERTRGRQPGDYDDDR

Sequence 1 LQCRRQGEGGGFS-REHCERRREEKYRE----------QQGR----EGGR
           -Q-RR--EGG-----E--ER-REE--R-----------QQ-R----EG--
Sequence 2 RQPRRE-EGGRWGPAEPREREREEDWRQPREDWRRPSHQQPRKIRPEGRE

Sequence 1 GEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDR
           GE---G----E--EE--R---P--F----F-T----Q-GR-RVLQ-F--R
Sequence 2 GEQEWGTPGSEVREETSRNN-PFYFPSRRFSTRYGNQNGRIRVLQRFDQR

Sequence 1 SELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDR
           S-------N-R----EA-P-T---P-H-DA--------G--T--------
Sequence 2 SKQFQNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNN

Sequence 1 RESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPGEFELFF
           R-S-N---G--L-I--G---Y--NR--N--L--AK---PV-TPG-FE-FF
Sequence 2 RKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFF

Sequence 1 GAGGENPESFFKSFSDEILEAAFNTRRDRLQRIF------------GQQR
           -A------S----FS---LEAAFN-------R--------------GQ-R
Sequence 2 PASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRR

Sequence 1 --------QGVIVKASEEQVRAMSRHEEGGIWPFGGESK---GTINIYQQ
           ---------GVIVK-S-E-V-----H--------G-E-------IN----
Sequence 2 RSTRSSDNEGVIVKVSKEHVQELTKHAKS-VSKKGSEEEDITNPINLRDG

Sequence 1 RPTHSNQYGQLHEVDASQYR-QLRDLDLTVSLANITQGAMTAPHYNSKAT
           -P--SN--G-L-EV-------QL-DLD-------I--GA---PH-NSKA-
Sequence 2 EPDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAM

Sequence 1 KIALVVDGEGYFEM-ACPHMSRSRGSYQGE---------TRGRPS-YQRV
           -I--V--G-G--E--A-------RG----E-----------G------R-
Sequence 2 VIVVVNKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRY

Sequence 1 ASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAG-RR
           --RL--G-V-I-PA-HP-VA---S---L--L-F--NA-NN----LAG---
Sequence 2 TARLKEGDVFIMPAAHP-VAINASSE-LHLLGFGINAENNHRIFLAGDKD

Sequence 1 NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA--
           NV--Q-E--AK-LAF------VE-----Q-E--F-----Q-Q--------
Sequence 2 NVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKE

Sequence 1 ---------------------
           ---------------------
Sequence 2 DQEEENQGGKGPLLSILKAFN



Alignment 21
Sequence 1:
Sequence 2: Allergen Vig r 2.0201, Sequence: B1NPN8
Sequence identity: 24.27 (142/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRI-PYVFE
           ----------------------------------------RG---P--F-
Sequence 2 MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFN

Sequence 1 -DQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVP
           -D--F-T-FR-Q-G--RVLQ-F--RS------ENYRV--L---P-T---P
Sequence 2 SDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP

Sequence 1 NHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINR
           -H-DA-----V--GR----LV--D-R-S----QG---KI-AGTT--L-N-
Sequence 2 HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNP

Sequence 1 DNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNT
           D-NE-L---KL--PV--P--F--FF----E---S----FS--ILEA-F--
Sequence 2 DDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDS

Sequence 1 RRDRLQRIF----GQQRQ--------GVIVKASEEQVRAMSRHEEGGIWP
           ------R------GQQ-Q--------GVIV----EQ-R----H-------
Sequence 2 DIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKK

Sequence 1 FGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQ
           ---------N---Q-P--SN--G---E-------QLRDLD----------
Sequence 2 SLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE

Sequence 1 GAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQ
           G----PHYNSKA--I-----G----E-------R-----Q-E-------Q
Sequence 2 GSLLLPHYNSKAIVILVINEGKANIELVG---QREQQKQQEEQEESWEVQ

Sequence 1 RVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGR
           R----L----V-IIPA--P----A-SN-N-----F--NA-NN----LAG-
Sequence 2 RYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAENNQRNFLAGE

Sequence 1 R-NVMNQLEREAKELAFGMPAREVEEVSRSQQE-EFFFKGPRQQQQGRAD
           --NV------E-----F------V------Q-E--F----P-QQ----A-
Sequence 2 KDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR

Sequence 1 A--------
           ---------
Sequence 2 KGGKGPFVY



Alignment 22
Sequence 1:
Sequence 2: Allergen Len c 1.0102, Sequence: CAD87731
Sequence identity: 23.25 (136/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           --------------------------------------------P--F--
Sequence 2 -------------------------------------SRSDQENPFIFKS

Sequence 1 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
           --F-T------G--R-LQKF--RS-------NYR-------P-T---P--
Sequence 2 NRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY

Sequence 1 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
           -DA-----V--G-----------R-S-N---GD--K--AGT-AYL-NRD-
Sequence 2 TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD

Sequence 1 NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR
           NE-L----L--PV--PG--E-F---G--N--SF---F---ILEAAFNT--
Sequence 2 NEDLRVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDY

Sequence 1 DRLQRIF-------GQQR------------QGVIVKASEEQVRAMSRHEE
           ---------------Q-R--------------VIVK-S-EQ----S----
Sequence 2 EEIEKVLLEDQEQEPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAK

Sequence 1 GGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSL
           --------------N-----P--SN--G---E-------QL-DLD--V--
Sequence 2 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS

Sequence 1 ANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSR----GSYQG
           --I--G----P-YNS-A--I--V--G-GYFE---------R---------
Sequence 2 VEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQ

Sequence 1 ETRGRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANN
           E-------QR----L--G-V---PAGHP----ASS--NL----F--NA-N
Sequence 2 EEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGINAKN

Sequence 1 NEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPR
           N----LAG---NV--Q--R--KELAF----REV------Q----F-----
Sequence 2 NQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQP

Sequence 1 QQQQGRADA
           -Q-------
Sequence 2 LQIE-----



Alignment 23
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 30.77 (180/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVAS-----ESKDPELKQCKHQCKAQQQ---
           M-------L-L----LAS--V-------E---P----C---C--------
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYR

Sequence 1 ----------ISKEQKEACIQACKEYIRQKHQGEHGRGGGDILEEE-VWN
           -------------E--E-C--------R--H--------G---E-E----
Sequence 2 NQACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQP

Sequence 1 RKSPIERLRECSRGCEQQHGEQREECLRRCQEEYQREKGRQDDDN-----
           R--P--R-R------E--H-EQ-EE------EE----KG-----------
Sequence 2 RPFPFPRPRQPHQ--EEEH-EQKEEHEWHRKEEKHGGKGSEEEQDEREHP

Sequence 1 -PTDP-EKQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGRG
           -P--P--K-------Q-------G--S-E--E---E---------E----
Sequence 2 RPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQES---

Sequence 1 EMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRS
           ---EG-E---E---------P--F----F-T-F--Q-G--RVLQ-F--RS
Sequence 2 ---EGSESQREPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRS

Sequence 1 ELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRR
           --L-----YR-------P-T---P-H-DA--------G-----LV--D-R
Sequence 2 QQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDR

Sequence 1 ESLNIKQGDILKINAGTTAYLINRDNNE--RLV-----------------
           -S-N---GD-L---AGTT-Y--N-DN-E--R-------------------
Sequence 2 DSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLR

Sequence 1 LAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQR
           ---L--PV--PG-FE-FF--------S----FS--ILEA---T-------
Sequence 2 MITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINK

Sequence 1 I-FGQ---QRQG-------VIVKASEEQVRAMSRHEEGGIWPFGGESKGT
           --FG----Q-QG-------VIV--S--Q-R--S-H---------------
Sequence 2 VLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKP

Sequence 1 INIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHY
           -N-----P--SN--G-L-E-------QLRDLD---S------GA---PH-
Sequence 2 FNLGSRDPIYSNKLGKLFEI-TQRNPQLRDLDVFLSVVDMNEGALFLPHF

Sequence 1 NSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTR
           NSKA--------GE---E---------R---Q---------------L--
Sequence 2 NSKAIVVLVINEGEANIELVGIKEQQQR---QQQEEQPLEVRKYRAELSE

Sequence 1 GTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQL
           -----IPAG-P----A-S--N-----F--NA-NN----LAG---NV--Q-
Sequence 2 QDIFVIPAGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQI

Sequence 1 EREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQGRADA-------
           -----ELAF---A---E----SQ-E--F----P-Q---G-----------
Sequence 2 PSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSI

Sequence 1 -----
           -----
Sequence 2 LRAFY



Alignment 24
Sequence 1:
Sequence 2: Allergen Len c 1.0101, Sequence: CAD87730
Sequence identity: 23.25 (136/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           --------------------------------------------P--F--
Sequence 2 -------------------------------------SRSDQENPFIFKS

Sequence 1 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
           --F-T------G--R-LQ-F--RS-------NYR-------P-T---P--
Sequence 2 NRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF

Sequence 1 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
           -DA-----V--G-----------R-S-N---GD--K--AGT-AYL-NRD-
Sequence 2 TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD

Sequence 1 NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR
           NE-L----L--PV--PG----F---G--N--SF---FS--ILEAAFNT--
Sequence 2 NEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEY

Sequence 1 DRLQRIF-------GQQRQG------------VIVKASEEQVRAMSRHEE
           ---------------Q-R--------------VIVK-S-EQ----S----
Sequence 2 EEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAK

Sequence 1 GGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSL
           --------------N-----P--SN--G---E-------QL-DLD--V--
Sequence 2 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS

Sequence 1 ANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQ--GET
           --I--G----P-YNS-A--I--V--G-G-FE-----------------E-
Sequence 2 VEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEE

Sequence 1 RGRP-----SYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVN
           -G---------QR---RL--G-V--IPAGHP----ASS--NL----F--N
Sequence 2 EGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGIN

Sequence 1 ANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFK
           A-NN----LAG---NV--Q--R--KELAF----REV------Q----F--
Sequence 2 AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFAN

Sequence 1 GPRQQQQGRADA
           ----Q-------
Sequence 2 AQPLQIE-----



Alignment 25
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAA33947
Sequence identity: 10.26 (60/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQ
           --------------------------S------------------N----
Sequence 2 --------------------------SKRAKSSSRKTISSEDKPFNLGSR

Sequence 1 RPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATK
           -P--S---G---E-------QLRDLD---S------GA---PH-NSKA--
Sequence 2 DPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIV

Sequence 1 IALVVDGEGYFEMACPHMSRSRGSYQGETRGRP-SYQRVASRLTRGTVVI
           I-----G----E-------------Q-E----P---------L-------
Sequence 2 ILVINEGDANIELV--GLKEQQQEQQQEEQ--PLEVRKYRAELSEQDIFV

Sequence 1 IPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQLEREAK
           IPAG-P-V--A-SN-N--------NA-NN----LAG---NV--Q------
Sequence 2 IPAGYPVVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQ

Sequence 1 ELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQGRADA------------
           ELAF---A--VE-----Q-E--F----P-----G----------------
Sequence 2 ELAFPGSAQAVEKLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY



Alignment 26
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 19.15 (112/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 ----------------------------------------MVSAMGDRTA

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGRER--EEEQEEQGRGRIPYVF
           S--------------------GRG---EGRE---EE--------R-----
Sequence 2 SAILALLLLSSWSLMVVMAYQGRG--MEGREKRVEEKAPRSPEDRGLFIL

Sequence 1 EDQHFITGFRTQHGRMRVLQKFTDRSELLRGIEN-YRVAILEAEPQTFIV
           ----------T--G--R------------RG------------EP-T---
Sequence 2 RRSKEV--LKTDAGEVRLMMGYR-----YRGNHSPMHIGFITMEPNTLYI

Sequence 1 PNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLIN
           P---DA----FV--G-----------------K-G----I-AG---Y--N
Sequence 2 PQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVN

Sequence 1 RDNNERL-VLAKL--LQPVSTPGEF-ELFFGAGGENPESFFKSFSDEILE
           -D--ERL--------L------G-----F---GG--P-S----F----L-
Sequence 2 SDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLS

Sequence 1 AAFNTRRDRLQRIFGQQRQGVIVK----ASEE---------------QVR
           AAFN---D-L--I---QR-G-I------A-E----------------Q--
Sequence 2 AAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEK

Sequence 1 AM-------SRHEEGGIWPF--------G-GE-----------SKGTINI
           -M----------EE---W----------G-G------------S-G--N-
Sequence 2 EMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNL

Sequence 1 YQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSK
           Y---P---N-YG-----D---Y--L----L-V-L-N---GAM--PH-N--
Sequence 2 YDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPT

Sequence 1 ATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTV
           AT-------G-G------P----------------------------G-V
Sequence 2 ATEYGIILRGSGTIQVVFPNGTAA----------------MNAKVSEGDV

Sequence 1 VIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREA
           --IP---PF---AS----L----F---A--N----L-G------------
Sequence 2 FWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGKSSLLHSMRGPE

Sequence 1 KELAFGMPAREVEEVSRSQQEEFFFK-GPRQQQQGRADA-----------
           ---AFG------E-----Q-E-------P---------------------
Sequence 2 LAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKKWKGEEVLVMK

Sequence 1 -----
           -----
Sequence 2 RGLFA



Alignment 27
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 17.78 (104/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED
           -----------K------------------------E----------F--
Sequence 2 -----------KTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLM

Sequence 1 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH
           ------F-T--G-MRVL-----R----R------------EP----VP--
Sequence 2 SNSTRVFKTDAGEMRVLKSHGGRI-FYR---HMHIGFISMEPKSLFVPQY

Sequence 1 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN
           -D-----F---G---------D-------K-GD---I--G---YL-N---
Sequence 2 LDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGE

Sequence 1 NERLVLAKLLQPVSTPG--EFELFFGAGGENPESFFKSFSDEILEAAFNT
           --RL-------P----G---F--F---GG-N--S----F---ILE-AFN-
Sequence 2 GQRLHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNE

Sequence 1 RRDRLQRIFGQQRQGVIV-------------------KASEEQVRAMSRH
           -R-----IF-----G-I-----------------------E-Q---M---
Sequence 2 SRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQD

Sequence 1 EE--------GGIWP------FGG-----ESKGTI------NIYQ-QRPT
           -E-----------W-------FG------E-K-T-------N-Y------
Sequence 2 QEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKAD

Sequence 1 HSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIAL
           --N-YG---------Y--L---D--V-L-----G-M-APH-N--------
Sequence 2 FKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTI

Sequence 1 VVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVIIPAG
           V--G-G------P--SR------------------------G-V---P--
Sequence 2 VLSGYGELHIGYPNGSRA----------------MKTKIKQGDVFVVPRY

Sequence 1 HPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKELAFG
           -PF--VAS----L----F---A--N----LAG-------L-------AFG
Sequence 2 FPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAASLLRTLMGPELSAAFG

Sequence 1 MPAREVEEVSRSQQEEFFFKGPRQQQQGRADA------------------
           ------------Q-E--------------A--------------------
Sequence 2 VSEDTLRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSFANDVV

Sequence 1 ----
           ----
Sequence 2 MDVF



Alignment 28
Sequence 1:
Sequence 2: Allergen Pru du 8.0101, Sequence: A0A516F3L2
Sequence identity: 7.18 (42/585)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MATMTKAELPLLVLFLSTLLLATSVPSVRAQVTCEEGCYSISDQSKVGEC

Sequence 1 ---------------------------------------MSCGGRLCLVL
           ----------------------------------------------C---
Sequence 2 LQMCSSHGQSCEDRCMREARWPQQQEQCLRMCRQQEQGHHLPCREQCIRS

Sequence 1 FALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKE--ACIQACKEYI
           --------------------QC---CK----I-----E---C---C----
Sequence 2 PDREMCERACQQQQGQGGGRQCLQRCK---MITRDPRERLKCVRTCTQGQ

Sequence 1 RQK-HQGEHGRGGGDIL-EEEVWNRKSPIERLRECSRGCEQQHGEQREE-
           -Q---QG--------------------P--R--EC---C--Q---Q--E-
Sequence 2 QQGVFQGQQQQQQVEQQCRQHCQSERDPM-RQQECQEYCVGQMMQQEYEQ

Sequence 1 -CLRRCQ-EEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGFSREH
           -C--RCQ-E---RE---Q-----T----Q--QC---C--QG--G----E-
Sequence 2 QCRSRCQWERPRREQQEQCQEECTEKIRQLEQCQEGCKIQGQYGPQQQE-

Sequence 1 CERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFEDQHFI
           C-R---E-----QG------------------------------------
Sequence 2 CQRMCREQFEQGQGIRMVA-------------------------------

Sequence 1 TGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVIIPAGH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKELAFGM
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PAREVEEVSRSQQEEFFFKGPRQQQQGRADA
           -------------------------------
Sequence 2 -------------------------------



Alignment 29
Sequence 1:
Sequence 2: Allergen Fag e 3.0101, Sequence: A5HIX6
Sequence identity: 4.96 (29/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------C---C----Q---E--E-
Sequence 2 -------------------GDYPFEPRRQIEHCRQRCQDRSQGFRETRE-

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNR-KSPIERLRECSRGCEQQ
           C---C------K--G----------------R---P----R-C---C--Q
Sequence 2 CLETC-----EKRAGFDDEPSKEVDSYTTDTRSRDPQQEFRQCRHRCQTQ

Sequence 1 H--GEQREECLRRCQEEYQREKGRQDDD------NPTDPEKQYQQCRLQC
           ---G-Q---C--RC-----R--G--D--------N---P---Y--C---C
Sequence 2 EEGGRQQRKCEQRCEKQLERQQGYDDEEFGQGRSNIGAPVRNYDDCTEMC

Sequence 1 RRQGEGGGFSREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGR
           --------F-----------------------------------------
Sequence 2 GGSPLCALFCE---------------------------------------

Sequence 1 GRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGT
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TAYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LEAAFNTRRDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGES
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA
           --------------------------------------------
Sequence 2 --------------------------------------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 18.80 (110/585)
Sequence 1 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF
           --------------------------------------------------
Sequence 2 ----------------------------------------------MALT

Sequence 1 SREHCERRREEKYREQQGREGGRGEMY-EGREREEEQEEQGRG--RIPYV
           S------------R-------G----Y------------Q-R---R----
Sequence 2 SLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCRVERL

Sequence 1 FEDQHFITGFRTQHGRMRVLQKFTDRSEL---LRGIENYRVAILEAEPQT
           ------I--F----G----L--F-DR--------G----R--I----P--
Sequence 2 TAQEPTIR-FESEAG----LTEFWDRNNQQFECAGVAAVRNVI---QPRG

Sequence 1 FIVPNHWDAESVVFVAKGRGTISLV--------------RQDRRESL---
           ---P----A-----V--GRG----V--------------RQDRR------
Sequence 2 LLLPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDR

Sequence 1 -----NIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPGE----
           --------QGDIL---AG-T----N----E-L----LL------------
Sequence 2 HQKVRQFRQGDILALPAGLTLWFYN-NGGEPLITVALLDTGNAANQLDQT

Sequence 1 FELFFGAGGEN---------PES---------FFKSFSDEILEAAFNTRR
           F--FF-AG------------P------------F--F-DEIL--AF----
Sequence 2 FRHFFLAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDV

Sequence 1 DRLQRIFGQQR-QGVIVKASEEQVRAMSRHEEGGIW---PFGG-----ES
           ----R--GQ----G-IV-A-----------EE---W---P--G-----E-
Sequence 2 QTARRLKGQDDLRGRIVRAERLDI-VLPGEEEEERWERDPYSGANGLEET

Sequence 1 KGTINIYQ--QRPTHSNQY----GQLHEVDASQYRQLRDLDLTVSLANIT
           --T---------P-----Y----G------------L--L-L--------
Sequence 2 LCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLY

Sequence 1 QGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSY
           -----APH-N--A--I-----G-G-F-----H--RS-----G--R-----
Sequence 2 RNGLVAPHWNLNAHSIIYITRGSGRFQVV-GHTGRS--VFDGVVR-----

Sequence 1 QRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAG
           ---------G---I-P--------AS----L----F--N--N-----LAG
Sequence 2 --------EGQLIIVPQNYVVAKRASQDEGLEWISFKTN-DNAMTSQLAG

Sequence 1 RRNVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA
           R---------E----A------E---------E---F---------R---
Sequence 2 RLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSR

Sequence 1 --------------------
           --------------------
Sequence 2 PMSYMPKPFEYVLDVIKSMM


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.