The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Dac g 2

Sequence 255657

Full FASTA alignment

Sequence name:
Query sequence:
EAPVTFTVEKGSDEKNLALSIKYNKE

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Dac g 2AAB23303Go!2660.64.9e-13
2Dac g 2Q41183Go!3660.66.9e-13
3Lol p 2P14947Go!9756.43.5e-11
4Lol p 2CAA51775Go!8847.71.3e-08
5Phl p 3.01012JNZ_AGo!10837.91.4e-05
6Phl p 2P43214Go!12237.91.6e-05
7Cyn d 2CAA10346Go!12237.91.6e-05
8Dac g 2CAA10345Go!12237.91.6e-05
9Poa p 2CAA10348Go!12237.91.6e-05
10Dac g 3P93124Go!9637.22.0e-05
11Lol p 3P14948Go!9735.28.5e-05
12Tri a 3CAA90746Go!11833.43.5e-04
13Cyn d 1O04701Go!24631.62.5e-03
14Sor h 1.0101ABC58726Go!23931.33.1e-03
15Phl p 1P43213Go!26331.33.4e-03
16Poa p aCAA10520Go!26331.33.4e-03
17Hol l 1CAA10140Go!26331.33.4e-03
18Cyn d 1AAL14078Go!26230.65.5e-03
19Ory s 1AAF72991Go!26730.27.1e-03
20Phl p 1.0101CAA81613Go!26329.98.9e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Dac g 2, Sequence: AAB23303
Sequence identity: 100.00 (26/26)
Sequence 1 EAPVTFTVEKGSDEKNLALSIKYNKE
           EAPVTFTVEKGSDEKNLALSIKYNKE
Sequence 2 EAPVTFTVEKGSDEKNLALSIKYNKE



Alignment 2
Sequence 1:
Sequence 2: Allergen Dac g 2, Sequence: Q41183
Sequence identity: 100.00 (26/26)
Sequence 1 EAPVTFTVEKGSDEKNLALSIKYNKE----------
           EAPVTFTVEKGSDEKNLALSIKYNKE----------
Sequence 2 EAPVTFTVEKGSDEKNLALSIKYNKEGDSMAEVELK



Alignment 3
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: P14947
Sequence identity: 92.31 (24/26)
Sequence 1 EAPVTFTVEKGSDEKNLALSIKYNKE------------------------
           -APV-FTVEKGSDEKNLALSIKYNKE------------------------
Sequence 2 AAPVEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNG

Sequence 1 -----------------------------------------------
           -----------------------------------------------
Sequence 2 DGVWEIKSDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE



Alignment 4
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: CAA51775
Sequence identity: 76.92 (20/26)
Sequence 1 EAPVTFTVEKGSDEKNLALSIKYNKE------------------------
           -----FTVEKGSDEKNLALSIKY-KE------------------------
Sequence 2 ----EFTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNG

Sequence 1 ------------------------------------------
           ------------------------------------------
Sequence 2 DGVWEIKSDKPLKGPFNFRFVSEKGMWNVFDDVVPADFKVGT



Alignment 5
Sequence 1:
Sequence 2: Allergen Phl p 3.0101, Sequence: 2JNZ_A
Sequence identity: 57.69 (15/26)
Sequence 1 -----------EAPVTFTVEKGSDEKNLALSIKYNKE-------------
           --------------VTFTV-KGSD-K-L-L-IKY----------------
Sequence 2 RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI

Sequence 1 --------
           --------
Sequence 2 GKTYKPEE



Alignment 6
Sequence 1:
Sequence 2: Allergen Phl p 2, Sequence: P43214
Sequence identity: 57.69 (15/26)
Sequence 1 --------------------------EAPVTFTVEKGSDEKNLALSIKYN
           -----------------------------VTFTVEKGS-EK-LA---KY-
Sequence 2 MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 KE------------------------------------------------
           --------------------------------------------------
Sequence 2 GDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGM

Sequence 1 ----------------------
           ----------------------
Sequence 2 KNVFDDVVPEKYTIGATYAPEE



Alignment 7
Sequence 1:
Sequence 2: Allergen Cyn d 2, Sequence: CAA10346
Sequence identity: 57.69 (15/26)
Sequence 1 --------------------------EAPVTFTVEKGSDEKNLALSIKYN
           -----------------------------VTFTVEKGS-EK-LA---KY-
Sequence 2 MSMASSSSSGLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 KE------------------------------------------------
           --------------------------------------------------
Sequence 2 GDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLKGPFNFRFLTEKGM

Sequence 1 ----------------------
           ----------------------
Sequence 2 KNVFDDVVPEKYTIGATYAPEE



Alignment 8
Sequence 1:
Sequence 2: Allergen Dac g 2, Sequence: CAA10345
Sequence identity: 57.69 (15/26)
Sequence 1 --------------------------EAPVTFTVEKGSDEKNLALSIKYN
           -----------------------------VTFTVEKGS-EK-LA---KY-
Sequence 2 MSMASSSSSGLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 KE------------------------------------------------
           --------------------------------------------------
Sequence 2 GDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGM

Sequence 1 ----------------------
           ----------------------
Sequence 2 KNVFDDVVPEKYTIGATYAPEE



Alignment 9
Sequence 1:
Sequence 2: Allergen Poa p 2, Sequence: CAA10348
Sequence identity: 57.69 (15/26)
Sequence 1 --------------------------EAPVTFTVEKGSDEKNLALSIKYN
           -----------------------------VTFTVEKGS-EK-LA---KY-
Sequence 2 MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYE

Sequence 1 KE------------------------------------------------
           --------------------------------------------------
Sequence 2 GDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGM

Sequence 1 ----------------------
           ----------------------
Sequence 2 KNVFDDVVPEKYTIGATYAPEE



Alignment 10
Sequence 1:
Sequence 2: Allergen Dac g 3, Sequence: P93124
Sequence identity: 57.69 (15/26)
Sequence 1 EAPVTFTVEKGSDEKNLALSIKYNKE------------------------
           ---VTF-VEKGSD-K-L-L-IKY---------------------------
Sequence 2 -VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKG

Sequence 1 -----------------------------------------------
           -----------------------------------------------
Sequence 2 NLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE



Alignment 11
Sequence 1:
Sequence 2: Allergen Lol p 3, Sequence: P14948
Sequence identity: 53.85 (14/26)
Sequence 1 EAPVTFTVEKGSDEKNLALSIKYNKE------------------------
           ---V--TVEKGSD-K-L-L-IKY---------------------------
Sequence 2 -TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKG

Sequence 1 ------------------------------------------------
           ------------------------------------------------
Sequence 2 NLWEVKSAKPLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN



Alignment 12
Sequence 1:
Sequence 2: Allergen Tri a 3, Sequence: CAA90746
Sequence identity: 50.00 (13/26)
Sequence 1 ---------------------EAPVTFTVEKGSDEKNLALSIKYNKE---
           ------------------------V--TV-KGSD-K-LAL-I-Y------
Sequence 2 MASASRMLTVAVLAALFAGAMAVKVKLTVQKGSDKKKLALKIDYTRPNDS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LSEVELRQYGSEEWQPLTKKGDVWEVSCSKPLVGPFNFRFLSKNGMKKVF

Sequence 1 ------------------
           ------------------
Sequence 2 DEVFSTDFKIGKTYEPEY



Alignment 13
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: O04701
Sequence identity: 42.31 (11/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEH

Sequence 1 --------------------------------------------EAPVTF
           ------------------------------------------------TF
Sequence 2 IAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITF

Sequence 1 TVEKGSDEKNLALSIKYNKE------------------------------
           --EKGS----LAL--KY---------------------------------
Sequence 2 HIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRI

Sequence 1 ----------------------------------------------
           ----------------------------------------------
Sequence 2 DPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA



Alignment 14
Sequence 1:
Sequence 2: Allergen Sor h 1.0101, Sequence: ABC58726
Sequence identity: 50.00 (13/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PPKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FNSMGACGNLPIFKDGLCGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQ

Sequence 1 ------------------------------------------EAPVTFTV
           ---------------------------------------------VTF-V
Sequence 2 IAAYHFDLAGHAFGAMAKKGQEEKLAKAGIIDMKFRRVKCKYGEKVTFHV

Sequence 1 EKGSDEKNLALSIKYNKE--------------------------------
           EKGS----LAL--KY-----------------------------------
Sequence 2 EKGSNPNYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKHSWGAIWRKDS

Sequence 1 ---------------------------------------
           ---------------------------------------
Sequence 2 PDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK



Alignment 15
Sequence 1:
Sequence 2: Allergen Phl p 1, Sequence: P43213
Sequence identity: 50.00 (13/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSA

Sequence 1 ----------------EAPVTFTVEKGSDEKNLALSIKYNKE--------
           -------------------VTF-VEKGS----LAL--KY-----------
Sequence 2 GELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTSYESK



Alignment 16
Sequence 1:
Sequence 2: Allergen Poa p a, Sequence: CAA10520
Sequence identity: 50.00 (13/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 ----------------EAPVTFTVEKGSDEKNLALSIKYNKE--------
           -------------------VTF-VEKGS----LAL--KY-----------
Sequence 2 GELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTAYASK



Alignment 17
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: CAA10140
Sequence identity: 50.00 (13/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 ----------------EAPVTFTVEKGSDEKNLALSIKYNKE--------
           -------------------VTF-VEKGS----LAL--KY-----------
Sequence 2 GELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTAYESK



Alignment 18
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: AAL14078
Sequence identity: 46.15 (12/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 ------------EAPVTFTVEKGSDEKNLALSIKYNKE------------
           ----------------TF-VEKGS----LAL--KY---------------
Sequence 2 LQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 ------------
           ------------
Sequence 2 KPDTVYKSKIQF



Alignment 19
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72991
Sequence identity: 46.15 (12/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKA

Sequence 1 ----------------EAPVTFTVEKGSDEKNLALSIKYNKE--------
           ----------------E--VTF-VEKGS-----A---KY-----------
Sequence 2 GIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVI

Sequence 1 -----------------
           -----------------
Sequence 2 PDNWKANALYKSEIQVD



Alignment 20
Sequence 1:
Sequence 2: Allergen Phl p 1.0101, Sequence: CAA81613
Sequence identity: 46.15 (12/26)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA

Sequence 1 ----------------EAPVTFTVEKGSDEKNLALSIKYNKE--------
           -------------------VTF-VEKGS----LAL--K------------
Sequence 2 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTAYESK


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.