The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Phl p 1.0101

Sequence 3901094

Full FASTA alignment

Sequence name:
Query sequence:
MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
PEGWKADTAYESK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Phl p 1.0101CAA81613Go!263364.12.2e-102
2Phl p 1P43213Go!263344.91.4e-96
3Poa p aCAA10520Go!263339.84.6e-95
4Hol l 1CAA10140Go!263337.81.8e-94
5Hol l 1P43216Go!265333.53.6e-93
6Lol p 1.0103CAB63699Go!263325.97.1e-91
7Hol l 1.0102CAA93121Go!248322.76.0e-90
8Lol p 1P14946Go!263320.43.2e-89
9Lol p 1.0101AAA63279Go!263319.27.2e-89
10Pha a 1Q41260Go!269316.35.6e-88
11Lol p 1.0102AAA63278Go!252312.57.1e-87
12Ory s 1AAF72983Go!267276.16.9e-76
13Ory s 1AAF72991Go!267260.82.8e-71
14Cyn d 1.0203AAL14079Go!262249.38.2e-68
15Cyn d 1.0202AAL14077Go!262249.38.2e-68
16Cyn d 1AAL14078Go!262247.72.4e-67
17Ory s 1Q40638Go!263246.36.3e-67
18Cyn d 1.0201AAK96255Go!244245.79.1e-67
19Cyn d 1.0204AAF80379Go!244245.11.4e-66
20Cyn d 1O04701Go!246237.13.6e-64
21Pas n 1.0101ACA23876Go!265236.94.3e-64
22Sor h 1.0101ABC58726Go!239235.31.2e-63
23Ory s 1AAF72990Go!269233.45.0e-63
24Zea m 1P58738Go!269232.87.5e-63
25Ory s 1AAF72987Go!275190.73.7e-50
26Ory s 1AAF72984Go!268190.15.4e-50
27Ory s 1AAF72989Go!271182.31.2e-47
28Ory s 1AAB61710Go!261182.11.4e-47
29Tri a ps93AAD10496Go!271182.11.4e-47
30Ory s 1AAF72985Go!286180.25.7e-47
31Zea m 1Q07154Go!191172.76.9e-45
32Ory s 1AAF72988Go!327158.12.9e-40
33Gly m 2AAA50175Go!277155.41.5e-39
34Ory s 1AAF72986Go!275150.54.5e-38
35Ara t expansinCAB37496Go!26589.41.1e-19
36Ory s 1AAG13596Go!27583.75.9e-18
37Ory s 1BAA85432Go!28478.32.7e-16
38Cyn d 2CAA10346Go!12263.82.5e-12
39Dac g 2CAA10345Go!12263.14.3e-12
40Poa p 2CAA10348Go!12263.14.3e-12
41Phl p 2P43214Go!12263.14.3e-12
42Dac g 1.0101Q7M1X8Go!3455.62.1e-10
43Lol p 2P14947Go!9756.53.4e-10
44Lol p 2CAA51775Go!8853.52.4e-09
45Dac g 3P93124Go!9652.35.8e-09
46Ant o 1.0101Q7M1X6Go!3249.91.0e-08
47Cyn d 15AAP80171Go!11250.91.9e-08
48Phl p 3.01012JNZ_AGo!10848.11.2e-07
49Lol p 3P14948Go!9744.51.3e-06
50Tri a 3CAA90746Go!11840.92.0e-05

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Phl p 1.0101, Sequence: CAA81613
Sequence identity: 100.00 (263/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
Sequence 2 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
Sequence 2 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
Sequence 2 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADTAYESK
Sequence 2 PEGWKADTAYESK



Alignment 2
Sequence 1:
Sequence 2: Allergen Phl p 1, Sequence: P43213
Sequence identity: 93.54 (246/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSSSVLLVV-LFAVFLGSA-GIPKVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPEACSGEPVVVHITDDNEEPIA-YHFDLSG-AFG-MAKKGDEQKLRSA
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E-QFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVK-V-GDGDVVAVD
Sequence 2 GELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWI-LKESWGAIWRIDTP--L-GPFTVRYTTEGGTK-EA-DVI
Sequence 2 IKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADT-YESK
Sequence 2 PEGWKADTSYESK



Alignment 3
Sequence 1:
Sequence 2: Allergen Poa p a, Sequence: CAA10520
Sequence identity: 91.25 (240/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSSSVLLVVALFAVFLG-AHGI-KVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYKDVDK-PFSGMTGCGNTPIFKSGRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPE-CSGEPV-VHITDDNEEPIAAYHFDLSG-AFG-MAKKG-EQKLRSA
Sequence 2 TKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E--FRRVKC-YPEGTKVTFHVEKGSNPNYLALLVK-V-GDGDVVAVD
Sequence 2 GELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWI-LKESWG-IWR-DTP--L-GPFTVRYTTEGGTKGEA-DVI
Sequence 2 IKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADTAY-SK
Sequence 2 PEGWKADTAYASK



Alignment 4
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: CAA10140
Sequence identity: 90.49 (238/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSS-VLLVVALFAVFLG-AHGI-KVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPE-CSGEP-VVHITDDNEEPIAAYH-DLSG-AFG-MAKKG-EQKLRSA
Sequence 2 TKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E--FRRVKC-YP-GTKVTFHVEKGSNPNYLALLVK-V-GDGDVVAVD
Sequence 2 GELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWI-LKESWGA-WR-DTP--L-GPFTVRYTTEGGTK-EA-DVI
Sequence 2 IKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADTAYESK
Sequence 2 PEGWKADTAYESK



Alignment 5
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: P43216
Sequence identity: 90.11 (237/263)
Sequence 1 MASSS-SVLLVVA-LFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTW
           MASSS-SVLL-VA-LFAVFLGSAHGI-KVPPGPNITATYGD-WLDAKSTW
Sequence 2 MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTW

Sequence 1 YGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI
           YGKPT-AGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK-GRGCGSCFEI
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 KCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR
           KCTKPE-CSGEPV-VHITDDNEEPIA-YHFDLSG-AFGSMAKKG-EQKLR
Sequence 2 KCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLR

Sequence 1 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA
           SAGE-E--FRRVKCKYP-GTK-TFHVEKGSNPNYLALLVK---GDGDVVA
Sequence 2 SAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA

Sequence 1 VDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKD
           VDIKEKGKDKWI-LKESWGA-WR-DTP--L-GPFTVRYTTEGGTKGEA-D
Sequence 2 VDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAED

Sequence 1 VIPEGWKADTAYESK
           VIPEGWKADTAYE-K
Sequence 2 VIPEGWKADTAYEAK



Alignment 6
Sequence 1:
Sequence 2: Allergen Lol p 1.0103, Sequence: CAB63699
Sequence identity: 87.83 (231/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSSSVLLVVALFAVFLGSAHGI-KVPPGPNITA-YGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYKDVDK-PF-GMTGCGNTPIFK-GRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPE-CSGE-V-V-ITDDNEEPIA-YHFDLSG-AFGSMAKKG-EQKLRSA
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E-QFRRVKCKYP-GTK-TFHVEK-SNPNYLA-LVK-V-GDGDVVAVD
Sequence 2 GELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWI-LKESWGA-WRIDTP--L-GPFTVRYTTEGGTK-E--DVI
Sequence 2 IKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADT-Y--K
Sequence 2 PEGWKADTSYSAK



Alignment 7
Sequence 1:
Sequence 2: Allergen Hol l 1.0102, Sequence: CAA93121
Sequence identity: 84.41 (222/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           ---------------VFLGSAHGI-KVPPGPNITATYGD-WLDAKSTWYG
Sequence 2 ---------------VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK-GRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           -KPE-CSGEPV-VHITDDNEEPIA-YHFDLSG-AFGSMAKKG-EQKLRSA
Sequence 2 SKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E--FRRVKCKYP-GTK-TFHVEKGSNPNYLALLVK---GDGDVVAVD
Sequence 2 GELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWI-LKESWGA-WR-DTP--L-GPFTVRYTTEGGTKGEA-DVI
Sequence 2 IKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADTAYE-K
Sequence 2 PEGWKADTAYEAK



Alignment 8
Sequence 1:
Sequence 2: Allergen Lol p 1, Sequence: P14946
Sequence identity: 86.31 (227/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSSSVLLVVALFAVFLGSAHGI-KVPPGPNITA-YGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYK-VDK-PF-GMTGCGNTPIFK-GRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPE-CSGE-V-V-ITDDNEEPIA-YHFDLSG-AFGSMAKKG-EQ--RSA
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E-QFRRVKCKYP--TK-TFHVEK-SNPNYLA-LVK-V-GDGDVVAVD
Sequence 2 GELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWI-LKESWGA-WRIDTP--L-GPFTVRYTTEGGTK-E--DVI
Sequence 2 IKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADT-Y--K
Sequence 2 PEGWKADTSYSAK



Alignment 9
Sequence 1:
Sequence 2: Allergen Lol p 1.0101, Sequence: AAA63279
Sequence identity: 85.93 (226/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSSSVLLVVALFAVFLGSAHGI-KVPPGPNITA-YGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYK-VDK-PF-GMTGCGNTPIFK-GRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPE-CSGE-V-V-ITDDNEEPIA-YHFDLSG-AFGSMAKKG-EQ--RSA
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E-QFRRVKCKYP--TK-TFHVEK-SNPNYLA-LVK-V-GDGDVVAVD
Sequence 2 GELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKW--LKESWGA-WRIDTP--L-GPFTVRYTTEGGTK-E--DVI
Sequence 2 IKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADT-Y--K
Sequence 2 PEGWKADTSYSAK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pha a 1, Sequence: Q41260
Sequence identity: 84.03 (221/263)
Sequence 1 ------MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDA
           --------SSSS-L-V-AL-AVF-GSA-GI-KVPPGPNITA-YGDKWLDA
Sequence 2 MMKMVCSSSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDA

Sequence 1 KSTWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGS
           KSTWYGKPT-AGPKDNGGACGYKDVDK-PF-GMTGCGNTPIFK-GRGCGS
Sequence 2 KSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS

Sequence 1 CFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDE
           CFE-KC-KPE-CSGEP--VHITDDNEEPIA-YHFDLSG-AFGSMAKKG-E
Sequence 2 CFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEE

Sequence 1 QKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDG
           ---R-AGE-E-QFRRVKCKYP-GTK-TFHVEKGSNPNYLALLVK-V-GDG
Sequence 2 ENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDG

Sequence 1 DVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKG
           DVVAVDIKEKGKDKWI-LKESWGAIWRIDTP--L-GPFTVRYTTEGGTK-
Sequence 2 DVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKA

Sequence 1 EAKDVIPEGWKADTAYESK
           E--DVIPEGWKADT---SK
Sequence 2 EFEDVIPEGWKADTHDASK



Alignment 11
Sequence 1:
Sequence 2: Allergen Lol p 1.0102, Sequence: AAA63278
Sequence identity: 82.89 (218/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           -----------ALFAVFLGSAHGI-KVPPGPNITA-YGDKWLDAKSTWYG
Sequence 2 -----------ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGPKDNGGACGYKDVDK-PF-GMTGCGNTPIFK-GRGCGSCFEIKC
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           TKPE-CSGE-V-V-ITDDNEEPIA-YHFDLSG-AFGSMAKKG-EQ--RSA
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           GE-E-QFRRVKCKYP--TK-TFHVEKGSNPNYLA-LVK-V-GDGDVVAVD
Sequence 2 GELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKGKDKWI-LKESWGA-WRIDTP--L-GPFTVRYTTEGGTK-E--DVI
Sequence 2 IKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVI

Sequence 1 PEGWKADTAYESK
           PEGWKADT-Y--K
Sequence 2 PEGWKADTSYSAK



Alignment 12
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72983
Sequence identity: 71.10 (187/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSS--L--V---A-------G-PKVPPGPNIT--YGDKWL-AK-TWYG
Sequence 2 MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           -P--AGPKDNGGACGYKDVDK-PF-GM--CGN-PIFK-G-GCGSCFEIKC
Sequence 2 APKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           -KPEACS--P---H-TD-N-EPIAAYHFDLSG-AFG-MAK-G----LR-A
Sequence 2 SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           G----QFRRVKCKYP--TK-TFH-EK-SNPNYLALLVK-VAGDGDVV-V-
Sequence 2 GIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVE

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKG---W-ALKESWGAIWRIDTP--LKGPF-VR-TTEGG-K--A-D-I
Sequence 2 IKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAI

Sequence 1 PEGWKADTAYESK----
           P-GWKAD--Y-S-----
Sequence 2 PDGWKADSVYKSNVQAK



Alignment 13
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72991
Sequence identity: 66.92 (176/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASS---L--V---A-------G-PKVPPGPNITA-YG--WL-A--TWYG
Sequence 2 MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KP--AGP-DNGGACGYKD-DK-PF-GM--CGN-PIFK-G-GCGSCFE-KC
Sequence 2 KPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           -KPEACS--PV--HITD-N-EPIAAYHFDLSG-AFG-MAK-G----LR-A
Sequence 2 SKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           G----QFRRV-CKYP--TKVTFHVEKGSNPNY-A-LVK-V-GDGDVV-V-
Sequence 2 GIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVE

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           -KEKG---W--L-ESWGAIWRIDTP--LKGPF--R-TTE---K--A-DVI
Sequence 2 LKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVI

Sequence 1 PEGWKADTAYESK----
           P--WKA---Y-S-----
Sequence 2 PDNWKANALYKSEIQVD



Alignment 14
Sequence 1:
Sequence 2: Allergen Cyn d 1.0203, Sequence: AAL14079
Sequence identity: 66.54 (175/263)
Sequence 1 MASSSSVLLVVAL-FAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWY
           -------L-VVA---A---G-A-------PGPNITATYGDKWLDAK-T-Y
Sequence 2 ------MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFY

Sequence 1 GK-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI
           G--P--A-P-D-GGACGYKDVDK-PF--MTGCGN-PIFK-G-GCGSC-EI
Sequence 2 GSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEI

Sequence 1 KCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR
           KC--P--CSGEPV---ITD-N-E-IAAYHFDLSG-AFG-MAKKG-E-KLR
Sequence 2 KCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLR

Sequence 1 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA
           -AGE---QFRRVKC-YP--TK--FHVEKGSNPNYLALLVK--AGDG--V-
Sequence 2 KAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVS

Sequence 1 VDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKD
           VDIK-KG-D-----K-SWGAIWRID-P--LKGPFT-R-T-E-G---E--D
Sequence 2 VDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQED

Sequence 1 VIPEGWKADTAYESK---
           VIPE-WK-DT-Y-SK---
Sequence 2 VIPEDWKPDTVYKSKIQF



Alignment 15
Sequence 1:
Sequence 2: Allergen Cyn d 1.0202, Sequence: AAL14077
Sequence identity: 66.54 (175/263)
Sequence 1 MASSSSVLLVVAL-FAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWY
           -------L-VVA---A---G-A-------PGPNITATYGDKWLDAK-T-Y
Sequence 2 ------MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFY

Sequence 1 GK-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI
           G--P--A-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFK-G--CGSC-EI
Sequence 2 GSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEI

Sequence 1 KCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR
           KC--P--CSGEPV---ITD-N-E-IAAYHFDLSG-AFG-MAKKG-E-KLR
Sequence 2 KCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLR

Sequence 1 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA
           -AGE---QFRRVKC-YP--TK--FHVEKGSNPNYLALLVK--AGDG--V-
Sequence 2 KAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVS

Sequence 1 VDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKD
           VDIK-KG-D-----K-SWGAIWRID-P--LKGPFT-R-T-E-G---E--D
Sequence 2 VDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQED

Sequence 1 VIPEGWKADTAYESK---
           VIPE-WK-DT-Y-SK---
Sequence 2 VIPEDWKPDTVYKSKIQF



Alignment 16
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: AAL14078
Sequence identity: 65.40 (172/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           ---------V----A---G-A-------PGPNITATYGDKWLDAK-T-YG
Sequence 2 -----MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYG

Sequence 1 K-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           --P--A-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFK-G-GCGSC-EIK
Sequence 2 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIK

Sequence 1 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS
           C--P--CSGEPV---ITD-N-E-IAAYHFDLSG-AFG-MAKKG-E-KLR-
Sequence 2 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK

Sequence 1 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV
           AGE---QFRRVKC-YP--TK-TFHVEKGS-PNYLALLVK--AGDG--V-V
Sequence 2 AGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           DIK-KG-D-----K-SWGAIWR-D-P--LKGPFT-R-T-E-G---E--DV
Sequence 2 DIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDV

Sequence 1 IPEGWKADTAYESK---
           IPE-WK-DT-Y-SK---
Sequence 2 IPEDWKPDTVYKSKIQF



Alignment 17
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: Q40638
Sequence identity: 64.64 (170/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           MASSS--L--V---A----S--G-PKVPPGPNIT--YGDKWL-A------
Sequence 2 MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMV

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           -P----PKDNGGACGYKDVDK-PF-GM--CGN-PIFK-G-GCGSCFEIKC
Sequence 2 RPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           -KPEACS--P---H-TD-N-EPIAAYHFDLSG-A---MAK-G----LR-A
Sequence 2 SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           G----QFRRVKCKYP--TK-TFH-EK-SNPNYLALLVK-VAGDGDVV-V-
Sequence 2 GIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVE

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           IKEKG---W-ALKESWGAIWRIDTP--LKGPF-VR-TTEG-----A-D-I
Sequence 2 IKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAI

Sequence 1 PEGWKADTAYESK---
           P---------------
Sequence 2 PDPGRRQRVQVNVQAK



Alignment 18
Sequence 1:
Sequence 2: Allergen Cyn d 1.0201, Sequence: AAK96255
Sequence identity: 63.50 (167/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           ----------------------------PGPNITATYGDKWLDAK-T-YG
Sequence 2 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG

Sequence 1 K-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           --P--A-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFK-G--CGSC-EIK
Sequence 2 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK

Sequence 1 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS
           C--P--CSGEPV---ITD-N-E-IAAYHFDLSG-AFG-MAKKG-E-KLR-
Sequence 2 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK

Sequence 1 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV
           AGE---QFRRVKC-YP--TK--FHVEKGS-PNYLALLVK--AGDG--V-V
Sequence 2 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           DIK-KG-D-----K-SWGAIWRID-P--LKGPFT-R-T-E-G---E--DV
Sequence 2 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV

Sequence 1 IPEGWKADTAYESK---
           IPE-WK-DT-Y-SK---
Sequence 2 IPEDWKPDTVYKSKIQF



Alignment 19
Sequence 1:
Sequence 2: Allergen Cyn d 1.0204, Sequence: AAF80379
Sequence identity: 63.12 (166/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           ----------------------------PGPNITATYGDKWLDAK-T-YG
Sequence 2 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG

Sequence 1 K-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           --P--A-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFK-G--CGSC-EIK
Sequence 2 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK

Sequence 1 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS
           C--P--CSGEPV---ITD-N-E-IAAYHFDLSG-AFG-MAKKG-E-KLR-
Sequence 2 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK

Sequence 1 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV
           AGE---QFRRVKC-YP--TK--FHVEKGS-PNYLALLVK--AGDG--V-V
Sequence 2 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           DIK-KG-D-----K-SWGAIWR-D-P--LKGPFT-R-T-E-G---E--DV
Sequence 2 DIKPKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDV

Sequence 1 IPEGWKADTAYESK---
           IPE-WK-DT-Y-SK---
Sequence 2 IPEDWKPDTVYKSKIQF



Alignment 20
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: O04701
Sequence identity: 61.60 (162/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           ----------------------------PGPNITATYG-KWL-A--T-YG
Sequence 2 -----------------------AIGDKPGPNITATYGSKWLEARATFYG

Sequence 1 K-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           --P--A-P-D-GGACGYKDVDKPPF-GMT-CGN-PIFK-G-GC--C-EIK
Sequence 2 SNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYEIK

Sequence 1 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS
           C--P--CSGEPV-V-ITD-N-E-IAAYHFDLSG-AFG-MAKKG-E-KLR-
Sequence 2 CKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRK

Sequence 1 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV
           AGE---QFRRVKCKYP-GTK-TFH-EKGSN--YLALLVK--AGDG--VAV
Sequence 2 AGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           DIK----D--I--K-SWGAIWRID----LKGPF--R-T-EGG------DV
Sequence 2 DIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDV

Sequence 1 IPEGWKADTAYESK-----
           IP--WK-DT-Y-SK-----
Sequence 2 IPANWKPDTVYTSKLQFGA



Alignment 21
Sequence 1:
Sequence 2: Allergen Pas n 1.0101, Sequence: ACA23876
Sequence identity: 61.60 (162/263)
Sequence 1 MASSSSVLLVVALFAVFL-GSAHGIPKVPPGPNITATYGDKWLDAKSTWY
           M-S------V-A--A----G---G-PKVPPGPNIT--Y--KWL-AK-TWY
Sequence 2 MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWY

Sequence 1 GKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           G-P--AGP-DNGGACG-K-V--PP--G-T-CGN-PIFK-G-GCGSC-EI-
Sequence 2 GQPNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIR

Sequence 1 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS
           C-KPE-CSG-PV-V-ITD-N-EPIA-YHFDLSG-AFG-MAK-G---KLR-
Sequence 2 CNKPE-CSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGLNDKLRH

Sequence 1 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV
           -G-----FRRV-CKY--G-K--FHVEKGSNPNYLA-LVKFVA-DGD-V--
Sequence 2 YGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLM

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           --KEK--D-W---K-SWGAIWR-DTP--L--PF--R-T-E-G-K--A-DV
Sequence 2 ELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDV

Sequence 1 IPEGWKADTAYESK---
           IP--WK-DT-Y-S----
Sequence 2 IPVNWKPDTVYNSNVQF



Alignment 22
Sequence 1:
Sequence 2: Allergen Sor h 1.0101, Sequence: ABC58726
Sequence identity: 64.64 (170/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           ------------------------PKV--G-NIT-TYG--WL--K-TWYG
Sequence 2 -----------------------PPKVAKGKNITETYGSDWLERKATWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGP-DNGGACGYKDV-K-PF--M--CGN-PIFK-G--CGSCFEIKC
Sequence 2 KPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDGL-CGSCFEIKC

Sequence 1 TKPE--ACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR
           -KP----CSGE-VVVHITD-N-E-IAAYHFDL-G-AFG-MAKKG-E-KL-
Sequence 2 DKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEKLA

Sequence 1 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA
           -AG-----FRRVKCKY--G-KVTFHVEKGSNPNYLALLVK-V-GDGD-V-
Sequence 2 KAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVG

Sequence 1 VDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKD
           VDIKEKG-D----LK-SWGAIWR-D-P---K-P-TV--TTEGGTK----D
Sequence 2 VDIKEKGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDD

Sequence 1 VIPEGWKADTAYESK
           VIPEGWKADT-Y--K
Sequence 2 VIPEGWKADTTYTAK



Alignment 23
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72990
Sequence identity: 59.70 (157/263)
Sequence 1 -MASSSSVLLVVALFAVFLGSAH-GIPKVPPGPNITATYGDKWLDAKSTW
           ---------L-VA--A---G----G-PKVPPGPNIT--Y---WL-A--TW
Sequence 2 MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATW

Sequence 1 YGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI
           YG-P---G--DNGGACG-K-V--PP--GM--CGN-PIFK-GRGCGSC-E-
Sequence 2 YGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEV

Sequence 1 KCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR
           KC--P-ACS--PV-V-ITD-N-EPI-AYHFD-SG-AFG-MA--G-E--LR
Sequence 2 KCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELR

Sequence 1 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA
           -AG----QFRRV-CKYP-G-KVTFHVEKGSNPNYLA-LVKFVA-DGDV--
Sequence 2 KAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQ

Sequence 1 VDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKD
           -D--E-G---W---K-SWGAIWR-DT---LK-PF--R-TTE-G----AKD
Sequence 2 MDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKD

Sequence 1 VIPEGWKADTAYESK----
           VIP--W--D--Y-S-----
Sequence 2 VIPVNWMPDAIYVSNVQFY



Alignment 24
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: P58738
Sequence identity: 58.56 (154/263)
Sequence 1 -MASSSSVLLVVALFAVFL-GSAHGIPKVPPGPNITATYGDKWLDAKSTW
           ----------V-A--A----G---G-PKVPPGPNIT--Y--KWL-A--TW
Sequence 2 MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATW

Sequence 1 YGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI
           YG-P--AG--DNGGACG-K-V--PP-SGMT-CGN-PIFK-G-GCGSC-E-
Sequence 2 YGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEV

Sequence 1 KCT-KPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKL
           -C--KPE-CSG-PV-V-ITD-N-EPIA-YHFDLSG-AFGS-AK-G---K-
Sequence 2 RCKEKPE-CSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKI

Sequence 1 RSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVV
           R--G-----FRRV-CKYP-G-K--FH-EKG-NPNYLA-LVK-VA-DGD-V
Sequence 2 RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIV

Sequence 1 AVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAK
           ---I--K----W---K-SWGAIWR-DT---LKGPF--R-T-E-G-K--AK
Sequence 2 LMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAK

Sequence 1 DVIPEGWKADTAYESK----
           DVIP--W--D--Y-S-----
Sequence 2 DVIPANWRPDAVYTSNVQFY



Alignment 25
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72987
Sequence identity: 50.57 (133/263)
Sequence 1 ----MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKS
           ----M-S-----L------V--GS--G-P-V---------YG--WL-A--
Sequence 2 MAARMGSKVAAILAILSVLVVHGSCKGHP-VNYNVSDASAYGSGWLPARA

Sequence 1 TWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCF
           TWYG-PT-AGP-DNGGACG-K-V---PFS-MT-CGN-PIFK-G-GCGSC-
Sequence 2 TWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCY

Sequence 1 EIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQK
           -I-C-K---CSG----V-ITD-N--P-A-YHFDLSG-AFG-MAK-G---K
Sequence 2 QIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDK

Sequence 1 LRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDV
           LR--G---IQFRRV-C-YP-G-K--FHVE-GSNP-Y-A-LV-----DGDV
Sequence 2 LRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPVYFAVLVEYEDLDGDV

Sequence 1 VAVDIKEK------GKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEG
           V-VD--E-----------W----ESWG-IWR-D----L--PF--R-----
Sequence 2 VQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDS

Sequence 1 GTKGEAKDVIPEGWKADTAYESK----
           G----A--VIP--W-----Y-S-----
Sequence 2 GKTLVANNVIPANWSPNSNYRSIVQFS



Alignment 26
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72984
Sequence identity: 50.57 (133/263)
Sequence 1 -MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITA---TYGDKWLDAKS
           ---S-S----V-ALF--------------PG-N--A---T----W--A--
Sequence 2 MAFSISKKAAVAALFSFLVVTC--VAGARPG-NFSASDFTADPNWEVARA

Sequence 1 TWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCF
           TWYG-PT-AGP-D-GGACG-K-----PFS-MT-CGN-PIFK-G-GCGSC-
Sequence 2 TWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCY

Sequence 1 EIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQK
           -I-C----ACSG-P--V-ITD-N--P---YHFDLSG-AFG-MAK-G----
Sequence 2 QIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQ

Sequence 1 LRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDV
           LR-AG---IQF-RV-C--P-G-KVTFHVE-GSNP-Y-A-LV----GDGDV
Sequence 2 LRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLVEYEDGDGDV

Sequence 1 VAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEA
           V-VD--E-----W----ESWG-IWR-D----L--PF--R-T-E-G----A
Sequence 2 VQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVA

Sequence 1 KDVIPEGWKADTAYESK-----
           --VIP--W-----Y-S------
Sequence 2 SQVIPANWAPMAVYRSFVQYSS



Alignment 27
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72989
Sequence identity: 46.01 (121/263)
Sequence 1 --MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTW
           ---------L--V--------SA-------------------W--AK-TW
Sequence 2 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW

Sequence 1 YGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI
           YG-P--AG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV

Sequence 1 KCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR
           -C----ACSG----V-ITD-N--P---YHFDLSGIAFG--AK-G----LR
Sequence 2 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR

Sequence 1 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA
           -AG----QF-RV-C--P-G-KV-FHVE-GS-P-YLA-LV----GDGDV--
Sequence 2 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ

Sequence 1 VDIKEKGK--DKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEA
           VD-KE-G-----W----ESWG--WR-D----L--PF--R-----G----A
Sequence 2 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA

Sequence 1 KDVIPEGWKADTAYESK-----
           -DVIP--W---T-Y-S------
Sequence 2 PDVIPLNWTPNTFYRSFVQYSS



Alignment 28
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAB61710
Sequence identity: 49.05 (129/263)
Sequence 1 --MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTW
           ---AS---V-------A---G-A-G-------------Y---WL-AK-TW
Sequence 2 MAGASAKVVAMLLSVLATY-GFAAGV-----------VYTNDWLPAKATW

Sequence 1 YGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI
           YG-P--AGP-DNGGACG-K-----PF--MT-CGN-P-F--G-GCG-C--I
Sequence 2 YGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQI

Sequence 1 KCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR
           -CT----CSG-P--V-ITD-N--P-A-YHFDLSG-AFG-MA--G----LR
Sequence 2 RCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLR

Sequence 1 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA
           -AG---IQFRRV-C-Y--G--V-FHVE-GSNP-YLA-LV-F---DG-VV-
Sequence 2 HAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQ

Sequence 1 VDIKEK---GKDK--WIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTK
           -D--E----GK----W-----SWG-IWR-D----L-GP---R---E-G--
Sequence 2 LDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQT

Sequence 1 GEAKDVIPEGWKADTAYESK----
           --A--VIP--W-A-T-Y-SK----
Sequence 2 VIAHQVIPANWRANTNYGSKVQFR



Alignment 29
Sequence 1:
Sequence 2: Allergen Tri a ps93, Sequence: AAD10496
Sequence identity: 48.29 (127/263)
Sequence 1 -MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWY
           ----SS-----VAL------S------V---------Y---WL-AK-TWY
Sequence 2 MAGVSSNAIALVALLSMLFTSVRSA--VNYDTAVARSYTSGWLPAKATWY

Sequence 1 GKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           G-P--AGP-DNGGACG-K-V---P-S-M--CGN-PIF--G-GCG-C-EIK
Sequence 2 GAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIK

Sequence 1 C--TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKL
           C-------CSG-P----ITD-N--P-A-YH-DLSG-AFGSMAK-G----L
Sequence 2 CEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRL

Sequence 1 RSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVV
           R-AG----QFRRV-C--P-G-KVTFHV--GSNPNYLA-LV--V--DG-VV
Sequence 2 RHAGIIDMQFRRVPCNFP-GMKVTFHVQRGSNPNYLAVLVEYVNVDGTVV

Sequence 1 AVDIKE--KGKDK--WIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTK
           ---------G-----W-----SWG--WR-DT-----GPF--R-T---G--
Sequence 2 RMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKT

Sequence 1 GEAKDVIPEGWKADTAYESK----
           --A---IP--W--D-AY-S-----
Sequence 2 LVANNAIPAYWQQDHAYWSNLQFY



Alignment 30
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72985
Sequence identity: 46.01 (121/263)
Sequence 1 --------------MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITAT
           ----------------------------A-------------------A-
Sequence 2 MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAV

Sequence 1 YGDKWLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIF
           Y---W--A--TWYG-P--AGP-DNGGACG-K-----PF--MT-CGN-P-F
Sequence 2 YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLF

Sequence 1 KSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFG
           K-G-GCGSC--I-CTK---CSG----V-ITD-N--P-A--HFDLSG-AFG
Sequence 2 KDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFG

Sequence 1 SMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALL
           --AK-G---KLR--G---I-F-RV-C--P-G-K--FHVE--SNP-Y-A-L
Sequence 2 RLAKPGLNDKLRHSGIIDIEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVL

Sequence 1 VKFVAGDGDVVAVDIKEK----GK--DKWIALKESWGAIWRIDTPEVLKG
           V----GDGDVV-VD--E-----G----KW----ESWG-IWR-DT---L--
Sequence 2 VEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDTNHRLQA

Sequence 1 PFTVRYTTEGGTKGEAKDVIPEGWKADTAYESK----
           PF--R---E-G----A--VIP--W---T-Y-S-----
Sequence 2 PFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS



Alignment 31
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: Q07154
Sequence identity: 43.35 (114/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------MT-CGN-PIFK-G-GCGSC-E--C
Sequence 2 --------------------------MTACGNVPIFKDGKGCGSCYEVRC

Sequence 1 T-KPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS
           --KPE-CSG-PV-V-ITD-N-EPIA-YHFDLSG-AFGS-AK-G---KLR-
Sequence 2 KEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKLRH

Sequence 1 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV
           -G-----FRRV-CKYP-G-K--FH-EKG-NPNY-A-LVKFVA-DGD-V--
Sequence 2 CGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDIVLM

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           -I--K----W---K-SWGAIWR-DT---LKGPF--R-T-E-G-K--AKD-
Sequence 2 EIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDI

Sequence 1 IPEGWKADTAYESK----
           IP--W--D--Y-S-----
Sequence 2 IPANWRPDAVYTSNVQFY



Alignment 32
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72988
Sequence identity: 52.47 (138/263)
Sequence 1 ----------------------------------------------MASS
           ------------------------------------------------SS
Sequence 2 MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSS

Sequence 1 SSVLLVVALFAVFLGSAHGIPKVP-PGPNIT----ATYGDKWLDAKSTWY
           S----------V--------P--P-PG-----------G--WL-A--TWY
Sequence 2 SNSSTPSIPPPVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWY

Sequence 1 GKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           G-P--AGP-DNGGACG-K-V--PPFS-MT-CGN-P-FK-G-GCGSC--I-
Sequence 2 GAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR

Sequence 1 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS
           C----ACSG-P--V-ITD-N--P---YHFDLSG-AFG-MAK------LR-
Sequence 2 CVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRH

Sequence 1 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV
           AG---IQFRRV-C-YP-G--VTFHVE-GSNP-Y-A-LV----GDGDVV-V
Sequence 2 AGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQV

Sequence 1 DIKEK-----GKDK-----WIALKESWGAIWRIDTPEVLKGPFTVRYTTE
           D--E------G-D------W----ESWG-IWR-DT---L-GPF--R-T-E
Sequence 2 DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNE

Sequence 1 GGTKGEAKDVIPEGWKADTAYESK----
           -G----A--VIP--W---T-Y-S-----
Sequence 2 SGKTLIADQVIPADWQPNTVYSSIVQFD



Alignment 33
Sequence 1:
Sequence 2: Allergen Gly m 2, Sequence: AAA50175
Sequence identity: 44.11 (116/263)
Sequence 1 -----MASSSSVLLVVALFAVFL--GSAHGIPKVPPGPNITATYGDKWLD
           ---------S--L---A----FL---S----PK--------------W--
Sequence 2 MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSP

Sequence 1 AKSTWYGKPTAAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKSGRGC
           A--TWYG-P-A-G----GGACGY---V--PPFS-----G---I--SG-GC
Sequence 2 AVATWYG-P-ANGDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGC

Sequence 1 GSCFEIKCTKPEACSGEPVVVHITDDNEE--PIAAYHFDLSGIAFGSMAK
           GSC-E-KCT---ACSG-PV-V-ITD--------A-YHFDLSG-AFG-MA-
Sequence 2 GSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAI

Sequence 1 KGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFV
           -G----LR-AG---IQ-RR--C-YP-G----FHV--GSN--Y-A-LV---
Sequence 2 SGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGSNQEYFATLVEYE

Sequence 1 AGDGDVVAVDIKEK-GKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTT-
           -GDGD---V--KE------W-----SWGA-W--D----L--PF----TT-
Sequence 2 DGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTL

Sequence 1 EGGTKGEAKDVIPEGWKADTAYESK-----
           E-G----A--VIP-GW-----Y-S------
Sequence 2 ESGQTIVANNVIPAGWTPGQTYRSIVNFAT



Alignment 34
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72986
Sequence identity: 42.21 (111/263)
Sequence 1 ----MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKS
           ----------VL-----------------------------G--W-----
Sequence 2 MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGA

Sequence 1 TWYGKPTAAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKSGRGCGSC
           TWYG-P---G----GGACGY---V---PFS-M---G----FK-G-GCGSC
Sequence 2 TWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC

Sequence 1 FEIKCTKPEACSGEPVVVHITDDNEEPI---AAYHFDLSGIAFGSMAKKG
           --IKCT---ACSG-PV-V-ITD----------A-HFD-SG-AFG-MA--G
Sequence 2 YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRG

Sequence 1 DEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAG
           ----LRSAG---IQ--RV-C-------V-F-V--GSNP-YLA-LV----G
Sequence 2 MGDRLRSAGVLKIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANG

Sequence 1 DGDVVAVDI-KEKGKDKWIALKESWGAIWRI--DTPEVLKGPFTVRYTTE
           DGD--AV-I-K--G---W-A---SWGA-WR----T---L--PF--R-T--
Sequence 2 DGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIRLTSG

Sequence 1 GGTKGEAKDVIPEGWKADTAYESK-----
           -G----A--VIP-GW-A---Y-S------
Sequence 2 SGKVLVANNVIPSGWQAGLTYRSTVNYAA



Alignment 35
Sequence 1:
Sequence 2: Allergen Ara t expansin, Sequence: CAB37496
Sequence identity: 29.66 (78/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWL-DAKSTWY
           -----------------L--------V-------A---D--L---K----
Sequence 2 ----------------MLQGFLFLLSVVLLFSSSAAACDRCLHSSKAAYF

Sequence 1 GKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK
           ----A-------GAC-Y-------F-G--------I-K-G-GCG-CF---
Sequence 2 SSASAL----SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVR

Sequence 1 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKK--GDEQKL
           C--P--CS-----V--TD-N----------LS--AF--MAK---G----L
Sequence 2 CKNPTLCSSKGTTVIVTDLNKT--NQTDLVLSSRAFRAMAKPVVGADRDL

Sequence 1 RSAGEVEIQFRRVKCKYPEGTKVTFHVEKGS-NPNYLALLVKFVAGDGDV
           ---G-V-I--RRV-C-Y----K----VE--S-NPNYLA-------G---V
Sequence 2 LKQGIVDIEYRRVPCDYGN-KKMNVRVEESSKNPNYLAIKLLYQGGQTEV

Sequence 1 VAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGE-
           VA--I---G---W-----S-GA-W--D---V--G----R-----G--G--
Sequence 2 VAIYIAQVGSSHWSYMTRSHGAVWVTD--KVPNGALQFRFVVTAGYDGKM

Sequence 1 --AKDVIPEGWKADTAYESK--------------------
           -----V-P--W-A---Y-----------------------
Sequence 2 VWSQRVLPANWEAGKSYDAGVQITDIAQEGCDPCDDHIWN



Alignment 36
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAG13596
Sequence identity: 24.33 (64/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 ---------------MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCV

Sequence 1 KPTAAGPKD-----NGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSC
           ----AG--D-----N-G-CGY---------G---------F--G-GCG-C
Sequence 2 RRSKAGFRDSSIALNAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGAC

Sequence 1 FEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQ
           F---C-----CS-----V--TD------------LS--A---MA--G---
Sequence 2 FQVRCKDGKLCSTAGAKVVVTDEARSTNRT-DLVLSAAAYAAMARPGMAA

Sequence 1 KLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFV--AGD
           -LR----V-----RV-C-Y--G------VE--S-P----L---F----G-
Sequence 2 QLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPR-ELSIRFLYQGGQ

Sequence 1 GDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTK
           -D-VAVD----G---W-------G--W---T-----GP---R----GG--
Sequence 2 TDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVVTGGYD

Sequence 1 GE----AKDVIPEGWKADTAYESK--------------------
           G--------V-P--W-A---Y-----------------------
Sequence 2 GKWVWADGEVLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK



Alignment 37
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: BAA85432
Sequence identity: 30.42 (80/263)
Sequence 1 ----------MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYG-D
           ---------------------A----------------P-P-----Y---
Sequence 2 MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTS

Sequence 1 KWLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPP-FSGMTGCGNTPIFKS
           -W-D---T-YG-P---G--D-GGACGY---D-----S--T----TP-F--
Sequence 2 DWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLFAD

Sequence 1 GRGCGSCFEIKCTKPEACS-GEPVVVHITDDNEEPIAAY-----------
           G-GCG-C-E--C-K---C--G-P-VV-IT--N--P---Y-----------
Sequence 2 GNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPNDDGGWCNP

Sequence 1 ---HFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFH
           ---HFD-----F---A--------R-AG-V--Q-RRV-C----G------
Sequence 2 PRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCLQ

Sequence 1 VEKGSNPNYLALLVKFVAGDGDVVAVDIKEKGKD-KWIALKESWGAIWRI
           -----N---L-L-V--V-G-GDV-----K--G----WI-----WG-----
Sequence 2 ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQV

Sequence 1 DTPEVLKGPFTVRYTTEGGTKGE--AKDVIPEGWKADTAYESK----
           ----------TV--TT-----------D-I---W-----Y-------
Sequence 2 FAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY



Alignment 38
Sequence 1:
Sequence 2: Allergen Cyn d 2, Sequence: CAA10346
Sequence identity: 16.73 (44/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           ------------------------------------------------S-
Sequence 2 ----------------------------------------MSMASSSSSG

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           ------------------KVTF-VEKGSN---LA-LVK-----GD--A-V
Sequence 2 LLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKY---EGDTMAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           ---E-G-D-W-A-----G--W--D--E-LKGPF--R--TE-G-K----DV
Sequence 2 ELREHGSDEWVAMTKGEGGVWTFDSEEPLKGPFNFRFLTEKGMKNVFDDV

Sequence 1 IPEGWKADTAYESK-
           -PE-------Y----
Sequence 2 VPEKYTIGATYAPEE



Alignment 39
Sequence 1:
Sequence 2: Allergen Dac g 2, Sequence: CAA10345
Sequence identity: 16.35 (43/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           ------------------------------------------------S-
Sequence 2 ----------------------------------------MSMASSSSSG

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           ------------------KVTF-VEKGSN---LA-LVK-----GD--A-V
Sequence 2 LLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKY---EGDTMAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           ---E-G-D-W-A-----G--W--D--E-L-GPF--R--TE-G-K----DV
Sequence 2 ELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDV

Sequence 1 IPEGWKADTAYESK-
           -PE-------Y----
Sequence 2 VPEKYTIGATYAPEE



Alignment 40
Sequence 1:
Sequence 2: Allergen Poa p 2, Sequence: CAA10348
Sequence identity: 16.35 (43/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           ------------------------------------------------S-
Sequence 2 ----------------------------------------MSMASSSSSS

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           ------------------KVTF-VEKGSN---LA-LVK-----GD--A-V
Sequence 2 LLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKY---EGDTMAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           ---E-G-D-W-A-----G--W--D--E-L-GPF--R--TE-G-K----DV
Sequence 2 ELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDV

Sequence 1 IPEGWKADTAYESK-
           -PE-------Y----
Sequence 2 VPEKYTIGATYAPEE



Alignment 41
Sequence 1:
Sequence 2: Allergen Phl p 2, Sequence: P43214
Sequence identity: 16.35 (43/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           ------------------------------------------------S-
Sequence 2 ----------------------------------------MSMASSSSSS

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           ------------------KVTF-VEKGSN---LA-LVK-----GD--A-V
Sequence 2 LLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKY---EGDTMAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           ---E-G-D-W-A-----G--W--D--E-L-GPF--R--TE-G-K----DV
Sequence 2 ELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDV

Sequence 1 IPEGWKADTAYESK-
           -PE-------Y----
Sequence 2 VPEKYTIGATYAPEE



Alignment 42
Sequence 1:
Sequence 2: Allergen Dac g 1.0101, Sequence: Q7M1X8
Sequence identity: 12.55 (33/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------IPKVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 -----------------------IPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-AGP-------------------------------------------
Sequence 2 KPTGAGP-------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PEGWKADTAYESK
           -------------
Sequence 2 -------------



Alignment 43
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: P14947
Sequence identity: 14.45 (38/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           -------------------V-F-VEKGS----LAL--K-----GD--A-V
Sequence 2 ----------------AAPVEFTVEKGSDEKNLALSIKY-NKEGDSMAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           --KE-G---W-ALK------W-I-----LKGPF--R---E-G------DV
Sequence 2 ELKEHGSNEWLALKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMRNVFDDV

Sequence 1 IPEGWKADTAYESK
           -P---K--T-Y---
Sequence 2 VPADFKVGTTYKPE



Alignment 44
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: CAA51775
Sequence identity: 13.69 (36/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           ---------------------F-VEKGS----LAL--K-----GD--A-V
Sequence 2 --------------------EFTVEKGSDEKNLALSIKY-SKEGDAMAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           --KE-G---W-ALK------W-I-----LKGPF--R---E-G------DV
Sequence 2 ELKEHGSNEWLALKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMWNVFDDV

Sequence 1 IPEGWKADTAYESK
           -P---K--T-----
Sequence 2 VPADFKVGT-----



Alignment 45
Sequence 1:
Sequence 2: Allergen Dac g 3, Sequence: P93124
Sequence identity: 13.31 (35/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           ------------------KVTF-VEKGS-P--L-L--K-----GD--A-V
Sequence 2 -----------------VKVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           -----G---W--L----G--W-------L-GPF--R----GG-------V
Sequence 2 ELRQHGSEEWEPLTKK-GNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEV

Sequence 1 IPEGWKADTAYESK-
           IP---K--T-Y----
Sequence 2 IPTAFKIGTTYTPEE



Alignment 46
Sequence 1:
Sequence 2: Allergen Ant o 1.0101, Sequence: Q7M1X6
Sequence identity: 11.41 (30/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------I-KVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           KPT-A---------------------------------------------
Sequence 2 KPTGA---------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PEGWKADTAYESK
           -------------
Sequence 2 -------------



Alignment 47
Sequence 1:
Sequence 2: Allergen Cyn d 15, Sequence: AAP80171
Sequence identity: 15.59 (41/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           -------------------------------------------------A
Sequence 2 ------------------------------------------------MA

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           ---------------------FHVE--S-P---AL--K--A-------VD
Sequence 2 TLTFPVLLATMVGHAWCVNIIFHVEE-SSPKF-ALSIKDSAKE--ITQVD

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           --E-G-D-------S-G--W-ID-P--LKGP---R---EGG------DVI
Sequence 2 VREHGADNMDPMTKS-GDSWTIDKP--LKGPLNIRLRAEGGGSRVQDDVI

Sequence 1 PEGWKADTAYESK----
           PE-WKA-T-Y--K----
Sequence 2 PENWKAGTDYPTKLHFG



Alignment 48
Sequence 1:
Sequence 2: Allergen Phl p 3.0101, Sequence: 2JNZ_A
Sequence identity: 10.65 (28/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           -------------------VTF-V-KGS-P--L-L--K----------V-
Sequence 2 -----RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVE

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           ----G---W--L----G--W-------L-GPF--R----GG-------VI
Sequence 2 LRQHGSEEWEPLTKK-GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVI

Sequence 1 PEGWKADTAYESK-
           P--------Y----
Sequence 2 PTAFSIGKTYKPEE



Alignment 49
Sequence 1:
Sequence 2: Allergen Lol p 3, Sequence: P14948
Sequence identity: 11.41 (30/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-V
           -----------------TKV---VEKGS----L-L--K-----GD--A-V
Sequence 2 -----------------TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEV

Sequence 1 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV
           -----G---W-------G--W-------L-GP---R----GG-K-----V
Sequence 2 ELRQHGSEEWEPMTKK-GNLWEVKSAKPLTGPMNFRFLSKGGMKNVFDEV

Sequence 1 IPEGWKADTAYESK--
           IP--------Y-----
Sequence 2 IPTAFTVGKTYTPEYN



Alignment 50
Sequence 1:
Sequence 2: Allergen Tri a 3, Sequence: CAA90746
Sequence identity: 9.89 (26/263)
Sequence 1 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA
           --------------------------------------------------
Sequence 2 ---------------------------------------------MASAS

Sequence 1 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD
           ------------------KV---V-KGS----LAL-------------V-
Sequence 2 RMLTVAVLAALFAGAMAVKVKLTVQKGSDKKKLALKIDYTRPNDSLSEVE

Sequence 1 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI
           ----G---W--L----G--W-------L-GPF--R-----G-K-----V-
Sequence 2 LRQYGSEEWQPLTKK-GDVWEVSCSKPLVGPFNFRFLSKNGMKKVFDEVF

Sequence 1 PEGWKADTAYESK-
           ----K----YE---
Sequence 2 STDFKIGKTYEPEY


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.