The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Fag e 1

Sequence 29839419

Full FASTA alignment

Sequence name:
Query sequence:
MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR
RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI
SKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLE
QAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVV
LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILV
VPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANS
YDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Fag e 1Q9XFM4Go!538654.05.1e-189
2Fag e 1BAA21758Go!565466.11.9e-132
3Fag e 1BAA21760Go!504380.31.2e-106
4Pis v 5.0101EU410073Go!473181.11.0e-46
5Pis v 2.0101DQ631676Go!496164.41.2e-41
6Gly m 6.0501Q7GC77Go!517158.38.3e-40
7Ber e 2AAO38859Go!465152.54.2e-38
8Pru du 6.0101ADN39440Go!551152.54.7e-38
9Ses i 7.0101Q9AUD2Go!497151.87.2e-38
10Pru du 63EHK_AGo!531150.71.6e-37
11Ana o 2AAN76862Go!457149.04.4e-37
12Cor a 9AAL73404Go!515148.57.0e-37
13Car i 4.0101ABW86978Go!505142.83.7e-35
14Jug r 4.0101Q2TPW5Go!507141.96.9e-35
15Gly m 6.0301P11828Go!481138.66.3e-34
16Pis v 2.0201DQ631677Go!472137.51.3e-33
17Pru du 6.0201ADN39441Go!504135.27.0e-33
18Ses i 6.0101Q9XHP0Go!459134.11.4e-32
19Gly m 6.0401Q9SB11Go!563120.91.6e-28
20Sin a 2.0101Q2TLW0Go!510117.41.6e-27
21Ara h 3O82580Go!507107.12.0e-24
22Ara h 3AAC63045Go!510107.12.0e-24
23Gly m glycinin G2CAA68460Go!48596.72.6e-21
24Gly m 6.0201P04405Go!48596.72.6e-21
25Gly m glycinin G1AAA33966Go!49595.18.3e-21
26Gly m 6.0101P04776Go!49595.18.3e-21
27Ara h 4AAD47382Go!53093.33.0e-20

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 100.00 (538/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
Sequence 2 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR
           AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR
Sequence 2 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR

Sequence 1 RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI
           RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI
Sequence 2 RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI

Sequence 1 SKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLE
           SKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLE
Sequence 2 SKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLE

Sequence 1 QAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVV
           QAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVV
Sequence 2 QAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVV

Sequence 1 LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILV
           LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILV
Sequence 2 LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILV

Sequence 1 VPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANS
           VPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANS
Sequence 2 VPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANS

Sequence 1 YDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           YDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
Sequence 2 YDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 2
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 95.72 (515/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           MSTKLILSFSLCLMVLSCSAQLLPW-KGQRSRPH-GHQQF-HQCD-QRLT
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           ASEPSRRVRSEAGVTEIWD-DTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           PYITFVEQGRGVQGVVVPGCPETFQS-SEFEYP-SQRDQRSRQSES-ESS
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSR-------------------
           RGDQR-RQSESEE-SRGDQR-RQSESEEFSR-------------------
Sequence 2 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR

Sequence 1 -----------GDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITL
           -----------GDQHQKIFRIRDGDVIPSPAGVVQWTHN-GDNDLISITL
Sequence 2 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL

Sequence 1 YDANSFQNQLDENVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESQD
           YDANSFQNQLD-NVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES-D
Sequence 2 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD

Sequence 1 DEALLEANILSGFEDEILQEIFRNVDQETISKLRGENDQRGFIVQARDLK
           DEALLEANIL-GF-DEILQEIFRNVDQETISKLRG-NDQRGFIVQARDLK
Sequence 2 DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLK

Sequence 1 LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFRQNVNRPSRADV
           LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKF-QNVNRPSRADV
Sequence 2 LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADV

Sequence 1 FNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
           FNPRAGRINTV-SNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
Sequence 2 FNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY

Sequence 1 VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE
           VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE
Sequence 2 VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE

Sequence 1 LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV
           LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV
Sequence 2 LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV

Sequence 1 FRPFQSRDEKERERFSIV
           F-PFQSRDEKERERF---
Sequence 2 FLPFQSRDEKERERF---



Alignment 3
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 82.16 (442/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQ--FQHQCDIQR
           MSTKLILSFSLCLMVLSCSAQL-PWQKGQ-SRPHHG-QQ--FQHQCDIQR
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           LTASEPSRRVRSEAGVTEIWDHDTPEFRC-GFVAVRVVIQPGGLLLPSYS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE
           NAPYITFVEQGRGVQGVV-PGCPETFQS-SEFEYP-SQR---SRQSES--
Sequence 2 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES--

Sequence 1 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP
           ----------------------------EE-SRGDQHQKIFRIR-GDVIP
Sequence 2 ---------------------------EEESSRGDQHQKIFRIREGDVIP

Sequence 1 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE
           SPAGVVQWTHN-G--DLIS-TL-DANS---QLDENVR-FFLAGQS-----
Sequence 2 SPAGVVQWTHNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQS-----

Sequence 1 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE
           ----QR-TREEGSDRQSRES-DDEALL-ANILSGF-DEIL-E-FR-VD-E
Sequence 2 ----QRETREEGSDRQSRESDDDEALLGANILSGFQDEILHELFRDVDRE

Sequence 1 TISKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRG--GSGRS
           TISKLRGENDQRGFIVQA-DLKLRVP---EEE--RERGDR-RG--GSGRS
Sequence 2 TISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERGDRRRGQGGSGRS

Sequence 1 NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSA
           NG-EQ-FCNLKFR-N-N-P----VFNPRAGRINTV-SN-LPILEF-QLSA
Sequence 2 NGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSA

Sequence 1 QHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG
           QHVVLYKNAI-GPRWNLNAHSALYVTRGEGRVQVVGDEG-SVFDD-VQRG
Sequence 2 QHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRG

Sequence 1 QILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEV
           QILVVPQGFAVVLKAGREGLEWVELKN--NAITSPI-G-TSVLRAIPVEV
Sequence 2 QILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEV

Sequence 1 LANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           LANSYDISTKEA--LKNGRQEVEVFRPFQSRDEKERERFSIV
Sequence 2 LANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 4
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 39.59 (213/538)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQR
           M-----LS-S-CL--L---C-A-----Q-GQ-----------Q--C-I--
Sequence 2 MANPSLLSLSVCLLILFHGCLASR---QQGQQ----------QNECQIDQ

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP--RV--EAG--E-WD-----FRCAG----R--IQP-GL-LP-YS
Sequence 2 LDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE
           NAP-------G-G--G---PGCPET-Q-------P-----Q---Q---G-
Sequence 2 NAPTLMYIVEGEGMTGTLIPGCPETYQA------P-----QQGQQH--GQ

Sequence 1 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP
           SSR---------------------------F---D-HQKI-R-R-GD-I-
Sequence 2 SSR---------------------------FQ--DKHQKIQRFRKGDIIA

Sequence 1 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE
           -PAGV--W--N-G-------TL-D----QNQLD---R-F-LAG------E
Sequence 2 LPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNP----E

Sequence 1 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE
           D---Q-Q-------RQS------------NI--GF---IL-E-F--V-Q-
Sequence 2 DEFQQQQQQQSRGRRQSQQKSCN------NIFCGFDTKILAEVFQ-VEQS

Sequence 1 TISKLRGENDQRGFIVQAR-DLK-LRVPEEYEEE--LQRERGDRKRGGSG
           ----L--E-D-RG-IV----DL---R-P----E------E-----RG--G
Sequence 2 LVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRG

Sequence 1 RSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQL
           R-NGLE---C--K---N---PSR-D---P--GRI----S-NLPIL---QL
Sequence 2 RDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQL

Sequence 1 SAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQ
           SA---VL--NA---P-WN-NAHS--Y---G---VQVV---G--VFD--V-
Sequence 2 SAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVS

Sequence 1 RGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPV
           -GQI-VVPQ-FAVV--A-----EW---K--D-A--SP-AG-TSVLRA-P-
Sequence 2 EGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPE

Sequence 1 EVLANSYDISTKEAFRLK-NGRQEVEVFRPFQSRDEKERERFSIV
           EVLAN---IS---A---K-N--Q----------------------
Sequence 2 EVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA------



Alignment 5
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 42.94 (231/538)
Sequence 1 MSTKLILSFSL-CLMVLSCS-AQLLPWQKGQRSRPHHGHQQFQHQCDIQR
           M-----LSFSL--L----CS-AQ---------S------Q-FQ-QC-IQ-
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQI---EQVVNSQQRQQQQRFQTQCQIQN

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP-RR--SEAGVTE-WD-------CA-----R--IQ--GLL-PSY-
Sequence 2 LNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYD

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE
           NAP----V-QG-G--G-V-PGCPETFQ------------------S-S--
Sequence 2 NAPELVYVVQGSGIHGAVFPGCPETFQ----------------EESQS--

Sequence 1 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP
           ------RSR------------RS-QS-------G-QHQK---I--GDVI-
Sequence 2 ------RSRS----------ERSQQS-------GEQHQKVRPIQEGDVIA

Sequence 1 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE
           -PAGV--W--NNG---L----L-D-----NQLD---R-F-L-G---Q---
Sequence 2 LPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQQEIQ

Sequence 1 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE
           -----R------S-R-----Q--------NILS-F--EIL---F-N-D--
Sequence 2 GSGQSRSRSQSQSSRRGQQGQQSN-----NILSAFDEEILAQSF-NIDTQ

Sequence 1 TISKLRGENDQRGFIVQAR-DLKLRVP--EEYEEELQRERGDRKRGGSGR
           ----L--E--QRG-IV----DL----P---E-E-E---ER--R-R-----
Sequence 2 LARRLQKEKRQRGIIVRVQEDLEVLSPHRQEQEQEYEEERERRQR-----

Sequence 1 SNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLS
           -NGLE--FC------N-N-PSRADV-NPR-GR---V---NLPIL-F-QLS
Sequence 2 -NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQLS

Sequence 1 AQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQR
           A---VL---AIL-P-WN-NAHS--Y-TRG-GR-Q-V---G-SVFD-----
Sequence 2 AKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIRE

Sequence 1 GQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVE
           GQ--VVPQ-FAVV--A-----EWV--K------TS--AG--SV-RA-P--
Sequence 2 GQLVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLD

Sequence 1 VLANSYDISTKEAFRLKNGRQEVEVFRP---FQSRDEKERERFSIV----
           V--NS-DIS---A-RLK--R-E---F-P----Q-----ERER--------
Sequence 2 VIKNSFDISREDARRLKESRSETTIFAPGSSSQRKSQSERERQREREERE

Sequence 1 --
           --
Sequence 2 IH



Alignment 6
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 37.36 (201/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           ------------------------------S------------C----L-
Sequence 2 -----------MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLN

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--RV-SE-G--E-W----PE--CAG-----------GL-LPSYS--
Sequence 2 ALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPY

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P----V-QG-G--G---PGCPETF------E-P--Q------------SS
Sequence 2 PQMIIVVQGKGAIGFAFPGCPETF------EKPQQQ------------SS

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           R---RS-Q------------------------D-HQKI-----GDV---P
Sequence 2 RRGSRSQQQLQ---------------------DSHQKIRHFNEGDVLVIP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSK-QSRED
           -GV--WT-N-GD-----I-L-D---F-NQLD-N-R-F-LAG-------E-
Sequence 2 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPET

Sequence 1 RRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQET
           ---Q-Q----G---Q----Q--E-------LSGF----L---F-N----T
Sequence 2 MQQQQQQKSHGGRKQGQHQQQEEE--GGSVLSGFSKHFLAQSF-NTNEDT

Sequence 1 ISKLRGENDQRGFIVQARD-LKLRVP-------------EEYE-------
           --KLR---D-R--IV-----L----P-------------EEYE-------
Sequence 2 AEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPP

Sequence 1 ---------------EELQRERGD--------------RKRGGSGRSNGL
           ---------------EE----R-D--------------R-RG---R-NG-
Sequence 2 RRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTR-NGV

Sequence 1 EQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHV
           E---C--K---N--RPSRAD--NP-AGRI-T--S--LP-L----LSAQ-V
Sequence 2 EENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYV

Sequence 1 VLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQIL
           VLY-N-I--P-WNLNA-S--YVTRG-GRV-VV---G--VFD----RGQ-L
Sequence 2 VLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLL

Sequence 1 VVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLAN
           VVPQ-F-V----G--GLE-V--K---NA--S-I-----V-RAIP-EVL-N
Sequence 2 VVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIK---DVFRAIPSEVLSN

Sequence 1 SYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           SY---------LK----------P---------------
Sequence 2 SYNLGQSQVRQLKYQGNSGPLVNP---------------



Alignment 7
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 40.89 (220/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           -------------M-------L---------------Q-----C-IQRLT
Sequence 2 -------------MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLT

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--R---EAGV-E-WD-----FRCAG--A-R--I-P-GLLLP-Y-NA
Sequence 2 AQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P----V-QGRG--GV--PGCPETFQS-S-F---R-Q---R-R--------
Sequence 2 PKLYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQEEERGR--------

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           ----------------------------F---DQHQK------GD-I--P
Sequence 2 ----------------------------FQ--DQHQKVHHLKKGDIIAIP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR
           AGV--W--N-GD-DL---------S--NQLD-N-R-FFLAG---------
Sequence 2 AGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQ------

Sequence 1 RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFR-NVDQET
           RSQ-Q--E----R-----------L--N---GF--E-L--------D-ET
Sequence 2 RSQKQRGERYGLRGGQQ------ILADNVFKGFNMEALADVLGFGMDTET

Sequence 1 ISKLRGENDQRGFIVQA-RDLKLRVPEEYEEELQRERGDRKRGGSGRSNG
           --K-RGE-DQRG-IV-----LK---P----EEL----G----GG----NG
Sequence 2 ARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEG----GGY---NG

Sequence 1 LEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQH
           LE---C---F-QN---P--AD--NPRAGR--TV-S---PIL-F-QLSA--
Sequence 2 LEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMK

Sequence 1 VVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQI
           -VLY-NA---P-W-LNA-S--Y--RGE-RVQ-V---G--VFDDN---GQ-
Sequence 2 GVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQM

Sequence 1 LVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLA
           -VVPQ-F-VV--AG--G-EWV-----DNA--S--AG-TS-LR-IPV-VLA
Sequence 2 VVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLA

Sequence 1 NSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           N-Y--S--EA-R-K--R-E---F-P---------------
Sequence 2 NAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA-----



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 42.01 (226/538)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQR
           --------FSLCL------C-A--------Q-S-P-------Q-QC----
Sequence 2 --MAKAFVFSLCLLLVFNGCLAA----RQSQLS-P-------QNQCQLNQ

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP--R---EAG--E-W------F-CAG--A-R--IQ--GL-LPSYS
Sequence 2 LQAREPDNRIQAEAGQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQ-SGSEFEYPRSQ-RDQRSRQSES
           NAP------QGRGV-G-V--GCPETF--S-------R-Q---Q---Q---
Sequence 2 NAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQ

Sequence 1 GESSR------------GDQRSRQSESE----ESSRGDQRSRQSESEEFS
           GE--R------------G-Q--RQ---E----E---G-Q--R------F-
Sequence 2 GEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQG-QQGRPQQQQQFR

Sequence 1 RGDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQL
           --D-HQK--RIR-GDV---PAGV--W--N-GD--L----L----S--NQL
Sequence 2 QFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQL

Sequence 1 DENVRNFFLAGQ-----SKQSREDRRSQRQTREEGSDRQ--SRESQDDEA
           D-N-R-F-LAG--------Q-----R-Q------G---Q---R--Q----
Sequence 2 DQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQ

Sequence 1 LLEANILSGFEDEILQEIFRNVDQETISKLRGENDQRGFIVQAR-DLKLR
           ----N--SGF----L-----NV--ET---L-G-ND-R--I---R--L---
Sequence 2 GSGNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQIIRVRGNLDFV

Sequence 1 VP----------EEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFRQNV
           -P----------E---E-LQ-ER-----GG----NGLE--FC-L----N-
Sequence 2 QPPRGRQEREHEERQQEQLQQER--QQQGGQLMANGLEETFCSLRLKENI

Sequence 1 NRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWN
           --P-RAD-F-PRAGRI-T--S-NLPIL-F--LSA-----Y-N-I--P-WN
Sequence 2 GNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWN

Sequence 1 LNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAG
           -NAHS--YV-RG--RVQVV---G----D--VQ-GQ---VPQ---V---AG
Sequence 2 VNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAG

Sequence 1 REGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK
           --G-E----K---NA-----AG-TS-LRA-P-EVLAN-Y-IS---A--LK
Sequence 2 NQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLK

Sequence 1 NGRQEVEVFRPFQSRDEKERERFSIV
           --RQE-------Q-R-----------
Sequence 2 YNRQETIALSSSQQRRAVV-------



Alignment 9
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 42.01 (226/538)
Sequence 1 MSTKLILSFSLC--LMVLSCSAQL-----LPWQKGQRSRPHHGHQQFQHQ
           M-----LSF-----L-----SAQL-------WQ--Q----H----Q----
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHK--LQARTD

Sequence 1 CDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLL
           C---RLTA-EP--R--SEAG-TE-WD-----F-CAG--AVR-VIQP-GLL
Sequence 2 CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLL

Sequence 1 LPSYSNAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQ
           LP-Y-NAP----V--GRG-QG-V-PGC-ETF------------RD---RQ
Sequence 2 LPHYNNAPQLLYVVRGRGIQGTVIPGCAETFE-----------RDTQPRQ

Sequence 1 SESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRD
           ---------D-R-R---------------------F---D-HQK----R-
Sequence 2 ---------DRRRR---------------------FM--DRHQKVRQFRQ

Sequence 1 GDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQS
           GD----PAG---W--NNG---LI---L-D-----NQLD---R-FFLAG--
Sequence 2 GDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGNP

Sequence 1 KQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFR
           ---R-------QT-------Q--E----------NI--GF-DEIL---F-
Sequence 2 QGGRQSYFGRPQT-----EKQQGETK--------NIFNGFDDEILADAF-

Sequence 1 NVDQETISKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGS
           -VD--T---L-G--D-RG-IV-A--L----P-E-EEE---ER-D---G--
Sequence 2 GVDVQTARRLKGQDDLRGRIVRAERLDIVLPGEEEEE-RWER-DPYSG--

Sequence 1 GRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQ
           ---NGLE---C--K-R-N---P-RADV-NP--GRI----S--LP-L----
Sequence 2 --ANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLR

Sequence 1 LSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNV
           LSA---VLY-N----P-WNLNAHS--Y-TRG-GR-QVVG--GRSVFD--V
Sequence 2 LSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVV

Sequence 1 QRGQILVVPQGFAVVLKAGR-EGLEWVELKNDDNAITSPIAGKTSVLRAI
           --GQ---VPQ---V---A---EGLEW---K--DNA-TS--AG--S--RA-
Sequence 2 REGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAM

Sequence 1 PVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV----
           P-EV----Y--S--EA-RLK--R-E--VF------------R--------
Sequence 2 PEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKP

Sequence 1 ------------
           ------------
Sequence 2 FEYVLDVIKSMM



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 40.15 (216/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           ----------------------------------------Q-QC----L-
Sequence 2 --------------------------------ARQSQLSPQNQCQLNQLQ

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--R---EAG--E-W------F-CAG--A-R--IQ--GL-LPSYSNA
Sequence 2 AREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQ-SGSEFEYPRSQ-RDQRSRQSESGE
           P------QGRGV-G-V--GCPETF--S-------R-Q---Q---Q---GE
Sequence 2 PQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGE

Sequence 1 SSR------------GDQRSRQSESE----ESSRGDQRSRQSESEEFSRG
           --R------------G-Q--RQ---E----E---G-Q--R------F---
Sequence 2 QGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQG-QQGRPQQQQQFRQL

Sequence 1 DQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDE
           D-HQK--RIR-GDV---PAGV--W--N-GD--L----L----S--NQLD-
Sequence 2 DRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQ

Sequence 1 NVRNFFLAGQ-----SKQSREDRRSQRQTREEGSDRQ--SRESQDDEALL
           N-R-F-LAG--------Q-----R-Q------G---Q---R--Q------
Sequence 2 NPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGN

Sequence 1 EANILSGFEDEILQEIFRNVDQETISKLRGENDQRGFIVQAR-DLKLRVP
           --N--SGF----L-----NV--ET---L-G-ND-R--I-Q-R--L----P
Sequence 2 GNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQIIQVRGNLDFVQP

Sequence 1 -----EEYEEELQRERGDRKRGGSGR---SNGLEQAFCNLKFRQNVNRPS
           -----E---EE-Q-E-----R---G-----NGLE--FC-L----N---P-
Sequence 2 PRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPE

Sequence 1 RADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAH
           RAD-F-PRAGRI-T--S-NLPIL-F--LSA-----Y-N-I--P-WN-NAH
Sequence 2 RADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAH

Sequence 1 SALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGL
           S--YV-RG--RVQVV---G----D--VQ-GQ---VPQ---V---AG--G-
Sequence 2 SVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGF

Sequence 1 EWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQ
           E----K---NA-----AG-TS-LRA-P-EVLAN-Y-IS---A--LK--RQ
Sequence 2 EYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQ

Sequence 1 EVEVFRPFQSRDEKERERFSIV
           E-------Q-R-----------
Sequence 2 ETIALSSSQQRRAVV-------



Alignment 11
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 40.15 (216/538)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQR
           ---------S-C---L---C-A----WQ--------------Q--C-I-R
Sequence 2 --------LSVCFLILFHGCLASRQEWQQ-------------QDECQIDR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP--RV--EAG--E-WD-----FRCAG---VR--IQP-GLLLP-YS
Sequence 2 LDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE
           NAP----V-QG-G--G---PGCPET-Q-------P---R-Q-------G-
Sequence 2 NAPQLIYVVQGEGMTGISYPGCPETYQA------PQQGRQQ-------GQ

Sequence 1 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP
           S-R---------------------------F---D-HQKI-R-R-GD-I-
Sequence 2 SGR---------------------------FQ--DRHQKIRRFRRGDIIA

Sequence 1 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE
           -PAGV--W--N-G-------TL-D----QNQLD---R-F-LAG--K----
Sequence 2 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPK----

Sequence 1 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE
           D---Q-Q--------QSR-----------N--SGF--E-L-E-F--VD--
Sequence 2 DVFQQQQ------QHQSRGR---------NLFSGFDTELLAEAFQ-VDER

Sequence 1 TISKLRGENDQRGFIVQARDLKLRV--PE----EYEEELQRERGDRKRGG
           -I--L--E-D-RG-IV---D--LRV--P-----E---E---E--D-KR--
Sequence 2 LIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRW

Sequence 1 SGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFI
           --R-NG-E---C------N-N-P-RAD---P--GR--T--S-NLPIL---
Sequence 2 GQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWL

Sequence 1 QLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDN
           QLS----VLYKNA---P-WNLN-HS--Y---G-G-VQVV---G--VFD--
Sequence 2 QLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGE

Sequence 1 VQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAI
           V--GQ-LVVPQ-FAVV--A--E--EW---K--D-A-TSP-AG-TSVL---
Sequence 2 VREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGM

Sequence 1 PVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           P-EVLAN---IS---A---K---Q---------S------------
Sequence 2 PEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA-----



Alignment 12
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 43.12 (232/538)
Sequence 1 MSTKLIL-SFSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQ
           ---KLIL-SFSLCL-VL---C----L----G-R-------Q-----C---
Sequence 2 -MAKLILVSFSLCLLVLFNGC----LGINVGLRRQ----QQRYFGECNLD

Sequence 1 RLTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSY
           RL-A-EP--R---EA---E-WDH----F-CAG----R--I-P-GLLLP-Y
Sequence 2 RLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQY

Sequence 1 SNAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESG
           SNAP-----E-GRG--GV--PGCPETF------E-P--Q--Q--RQ---G
Sequence 2 SNAPELIYIERGRGITGVLFPGCPETF------EDPQQQSQQGQRQGQ-G

Sequence 1 ESSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVI
           -S-R--Q----------------------------D-HQKI---R-GD-I
Sequence 2 QSQRSEQ----------------------------DRHQKIRHFREGDII

Sequence 1 PSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAG-----Q
           --PAGV--W--N-GD-------L---N---NQLDEN-R-F-LAG------
Sequence 2 ALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEH

Sequence 1 SKQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIF
           --Q--------R---------Q----Q--E-----N--SGF--E-L---F
Sequence 2 QRQGQQQFGQRRRQQQHSHGEQGEQEQQGEG---NNVFSGFDAEFLADAF

Sequence 1 RNVDQETISKLRGENDQRGFIVQARD-LKLRVPE------------EYEE
           -NVD--T---L----D-R--IV-----L----PE------------E-E-
Sequence 2 -NVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQERES

Sequence 1 ELQRERGDRKRGGSGRS-NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRI
           E--RER--R--GG-GR--NG-E---C-L--R-N----SRAD------GRI
Sequence 2 EQERER-QRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRI

Sequence 1 NTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRV
           NTV-SN-LP-L---QLSA----L-------P-WNLNAHS--Y--RG--RV
Sequence 2 NTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARV

Sequence 1 QVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAI
           QVV-D-G--VFDD----GQ-L--PQ-FAV---A--EG-EWV--K--DNA-
Sequence 2 QVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQ

Sequence 1 TSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRD
           -SP-AG-TS--RA-P--VLAN---IS--EA-RLK--RQE----R---SR-
Sequence 2 ISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTLVR--SSRS

Sequence 1 EKERERFSIV------
           --ER-R-S--------
Sequence 2 SSERKRRSESEGRAEA



Alignment 13
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 42.94 (231/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           M-----LS--LCL---------L--Q-G-R-----G------QC---RL-
Sequence 2 MAKPILLSIYLCLIIVALFNGCLA-QSGGRQQHKFG------QCQLNRLD

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--R---EAGV-E-WD-------CAG---VR--I-P-GLLLP-YSNA
Sequence 2 ALEPTNRIEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P-------GRG--GV--PGCPETF--------------------------
Sequence 2 PQLVYIARGRGITGVLFPGCPETF--------------------------

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           -----------EES-R----S-Q----EF---D-HQKI---R-GD-I--P
Sequence 2 -----------EESQR---QSQQGQRREFQQ-DRHQKIRHFREGDIIAFP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAG--------Q
           AGV--W--N-G------I-L-D-----NQLD-N-RNF-LAG--------Q
Sequence 2 AGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLAGNPDDEFRPQ

Sequence 1 SKQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIF
           --Q--E--R-Q-Q-----------E-Q-D---L--N--SGF--E-L---F
Sequence 2 GQQEYEQHRRQQQHQQRRGEHG--EQQRD---LGNNVFSGFDAEFLADAF

Sequence 1 RNVDQETISKLRGENDQRGFI--VQARDLKLRVP------EEYEEELQRE
           -NVD-ET---L--END-RG-I--V--R-L----P-------E-EE---RE
Sequence 2 -NVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEERKERE

Sequence 1 R-----GDRK---RGGSGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAG
           R-------R----RGG----NGLE---C-L--R-N---PSRAD-----AG
Sequence 2 RERESESERRQSRRGGRD-DNGLEETICTLSLRENIGDPSRADIYTEEAG

Sequence 1 RINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEG
           RI-TV-S-NLPIL---QLSA----LY--A---P-WNLNAHS--Y--RG--
Sequence 2 RISTVNSHNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRA

Sequence 1 RVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDN
           -VQVV---G--VFDD----GQ-L--PQ-FAVV--A--EG-EWV--K---N
Sequence 2 EVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARDEGFEWVSFKTNEN

Sequence 1 AITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQS
           A--SP-AG-TS--RA-P-EVL-N---I----A-RLK--RQE----R---S
Sequence 2 AMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRLKFNRQESTLVRS-RS

Sequence 1 RDEKERERFSIV
           R------R----
Sequence 2 RSSRSERRAEV-



Alignment 14
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 43.68 (235/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           M-----LS--L-L-V------L---Q-G-R-------QQF--QC---RL-
Sequence 2 MAKPILLSIYLFLIVALFNGCLA--QSGGRQQ-----QQFG-QCQLNRLD

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--R---EAGV-E-WD-----F-CAG---VR--I-P-GLLLP-YSNA
Sequence 2 ALEPTNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P-------GRG--GV--PGCPETF--------------------------
Sequence 2 PQLVYIARGRGITGVLFPGCPETF--------------------------

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           -----------EES-R----S-Q--S-EF---D-HQKI---R-GD-I--P
Sequence 2 -----------EESQR---QSQQGQSREFQQ-DRHQKIRHFREGDIIAFP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAG--------Q
           AGV--W--N-G-N----I-L-D-N---NQLD-N-RNF-LAG--------Q
Sequence 2 AGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYLAGNPDDEFRPQ

Sequence 1 SKQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIF
           --Q--E--R-Q-Q-------R-----Q----L---N--SGF----L---F
Sequence 2 GQQEYEQHRRQQQRQQ----RPGEHGQQQRGLGN-NVFSGFDADFLADAF

Sequence 1 RNVDQETISKLRGENDQRGFI--VQARDLKL------RVPEEYEEELQRE
           -NVD-ET---L--END-R--I--V--R-L--------R---E-EE---RE
Sequence 2 -NVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERE

Sequence 1 R-----GDRK---RGGSGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAG
           R-------R----RGG----NGLE---C-L--R-N---PSRAD-----AG
Sequence 2 RERESESERRQSRRGGRD-DNGLEETICTLRLRENIGDPSRADIYTEEAG

Sequence 1 RINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEG
           RI-TV-S--LP-L---QLSA----LY--A---P-WNLNAHS--Y--RG--
Sequence 2 RISTVNSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRA

Sequence 1 RVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDN
           -VQVV---G--VFDD----GQ-L--PQ-FAVV--A--EG-EWV--K---N
Sequence 2 EVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNEN

Sequence 1 AITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQS
           A--SP-AG-TS--RA-P-EVLA----I----A-RLK--RQE----R---S
Sequence 2 AMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLKFNRQESTLVRSRPS

Sequence 1 RDEKER-ERFSIV
           R----R-ER---V
Sequence 2 RSRSSRSERRAEV



Alignment 15
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 34.20 (184/538)
Sequence 1 MSTKLILSFSLCLMVLS--CSAQLLPWQKGQRSRPHHGHQQFQHQCDIQR
           ---KL-LS--LC----S--C-A---------R--P-------Q--C-IQR
Sequence 2 -MAKLVLS--LCFLLFSGCCFAFSF------REQPQ------QNECQIQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-
Sequence 2 LNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYT

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE
           NAP------QG-G--G---PGCP-TF------E-P-------------G-
Sequence 2 NAPQEIYIQQGSGIFGMIFPGCPSTF------EEPQQK----------GQ

Sequence 1 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP
           SSR-------------------------------D-HQKI---R-GD-I-
Sequence 2 SSRPQ-----------------------------DRHQKIYHFREGDLIA

Sequence 1 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE
           -P-G---W--NN-D-------L-D-NSFQNQLD---R-F-LAG---Q---
Sequence 2 VPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFL

Sequence 1 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE
           ----Q-Q----G---Q----Q--E------ILSGF--E-L---F--VD--
Sequence 2 QYQPQKQ--QGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFV-VDRQ

Sequence 1 TISKLRGEND--QRGFIVQARDLKLRVPEEYEEELQR----ERGD----R
           ---KL-GEN-----G-IV-------------EE--QR----E--D-----
Sequence 2 IVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKD

Sequence 1 KRGGSGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPI
           K---S---NG-----C----R-N----S--D-FNP-AG-I-T--S---P-
Sequence 2 KHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPA

Sequence 1 LEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSV
           L----LSAQ---L-KNA---P--NLNA-S--Y---G---VQVV---G--V
Sequence 2 LSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERV

Sequence 1 FDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSV
           FD---Q-GQ-L-VPQ-FAV---------E-V--K--D-------AG--S-
Sequence 2 FDGELQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSL

Sequence 1 LRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           L-A-P-EV-----------A---KN---------P--S------------
Sequence 2 LNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQRRVVA------



Alignment 16
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 42.38 (228/538)
Sequence 1 MSTKLILSFSL-CLMVLSCS-AQLLPWQKGQRSRPHHGHQQFQHQCDIQR
           M-----LSFSL--L----CS-AQ---------S------Q-FQ-QC-IQ-
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQI---EQVVNSQQRQQQQRFQTQCQIQN

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP-RR--SEAGVTE-WD-------CA-----R--IQ--GLL-PSY-
Sequence 2 LNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYN

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE
           NAP----V-QG-G--G-V-PGCPETFQ----------------------E
Sequence 2 NAPELVYVVQGSGIHGAVFPGCPETFQ----------------------E

Sequence 1 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP
           -S----RS--S-SE-------RS-QS-------G-QHQK---IR-GD-I-
Sequence 2 ESQSQSRSQHSRSE-------RSQQS-------GEQHQKVRHIREGDIIA

Sequence 1 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE
           -PAGV--W--NNG---L----L-D-----NQLD---R-F-L-G---Q---
Sequence 2 LPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQQEIQ

Sequence 1 DR-RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQ
           ----S--Q-R---S-R----S---------NILS-F--EIL---F-N-D-
Sequence 2 GGGQSWSQSR---SSRKGQQSN--------NILSAFDEEILAQSF-NIDT

Sequence 1 ETISKLRGENDQRGFIVQAR-DLKLRVPEEYEEELQRERGDRKRGGSGRS
           ----KL--E--QRG-IV----DL----P---E-----E--D---------
Sequence 2 QLVKKLQREEKQRGIIVRVKEDLQVLSPQRQE----KEYSD---------

Sequence 1 NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSA
           NGLE--FC------N-N-PSRADV-NPR-GR-------NLPIL-F-QLS-
Sequence 2 NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSV

Sequence 1 QHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG
           ---VLY-NAI--P-WN-NAHS--Y-TRG-GR-Q-V---G-SVFD-----G
Sequence 2 EKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIREG

Sequence 1 QILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEV
           Q--VVPQ-FAVV--A---G-EWV--K----A--S--AG--SV-R--P--V
Sequence 2 QLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDV

Sequence 1 LANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           --NS-DIS---A--LK--R-E---F-P--SR----R------
Sequence 2 IQNSFDISREDAWNLKESRSEMTIFAP-GSRSQRQRN-----



Alignment 17
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 38.10 (205/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           ---------------------LL-------SR-H---Q----Q-----L-
Sequence 2 -------------------CLLLLFNGCLASRQHIFGQNKEWQ--LNQLE

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP-----SEAGVTE-W----P-F--AG---VR--I-P-GL-LPSY-NA
Sequence 2 AREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P-------GRGV-G-V-PGC-ETF-----------Q--Q--R-S------
Sequence 2 PQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPS------

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           ------RQ----E---G-Q---Q-E-------D-HQKI--IR-GD-I--P
Sequence 2 ------RQ----EGGQGQQQF-QGEDQQ----DRHQKIRHIREGDIIALP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR
           AGV--W--NNG---L----L-D-N--QNQLD---R-F-LAG---------
Sequence 2 AGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQ---DEF

Sequence 1 RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI
           --Q-Q-R------Q-------------NI-SGF----L-----NV--ET-
Sequence 2 NPQQQGRQQQQQQQGQQGNGN------NIFSGFDTQLLAQAL-NVNPETA

Sequence 1 SKLRGENDQRGFIVQAR-DLKLRVP-------------EEYEEELQRERG
           --L-G--D-R--IV-----L----P----------------E---QRER-
Sequence 2 RNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQRERE

Sequence 1 DRKR-----GGSGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTV
           ---R-----GG-G--NG-E--FC-----QN---PSRAD--NP--GRI--V
Sequence 2 EKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVV

Sequence 1 DSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVV
           --N-LPIL----LSA---VLY-NAI--P-W--NA----Y--RG--RVQVV
Sequence 2 NRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVV

Sequence 1 GDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSP
           ---G----DD-V--GQ----PQ--AV---A--EG-E------D-N--T--
Sequence 2 NENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNT

Sequence 1 IAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKE
           -AG-TSVLRA-P-EVL-N---IS--EA--LK--RQE--------------
Sequence 2 LAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPRGRL

Sequence 1 RERFSIV
           -------
Sequence 2 MSILGY-



Alignment 18
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 36.25 (195/538)
Sequence 1 -MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRL
           ----K--L--SL-L-V---SA--------Q---P-----Q---QC--QR-
Sequence 2 MVAFKFLLALSLSLLV---SAAI-----AQTREPRLTQGQ---QCRFQRI

Sequence 1 TASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           ----PS-R--SE-G-TE-WD-----F-CAG-VA-R--I-P-GL-LP-Y--
Sequence 2 SGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHP

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGES
           -P-----E-G-G-----VPGC-ET-Q--------RSQR------------
Sequence 2 SPRLVYIERGQGLISIMVPGCAETYQ------VHRSQRTME---------

Sequence 1 SRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPS
           -------R---SE---RG--R------------D-HQK--R-R-GD----
Sequence 2 -------RTEASEQQDRGSVR------------DLHQKVHRLRQGDIVAI

Sequence 1 PAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRED
           P-G---W--N-G--DL------D-N---NQLD---R-F-LAG----S-E-
Sequence 2 PSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSGEQ

Sequence 1 RRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQET
           ----RQT---------------------NI---F--E-L-E-F-NV-QET
Sequence 2 EQQARQTFH-------------------NIFRAFDAELLSEAF-NVPQET

Sequence 1 ISKLRGENDQRGFIVQARD-LKLRVPEEYEEELQRERGDRKRGGSGRSNG
           I-----E---RG-IV-AR-------P-E-------E-G-----G----NG
Sequence 2 IRRMQSEEEERGLIVMARERMTFVRPDE-------EEGEQEHRGRQLDNG

Sequence 1 LEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQH
           LE--FC--KFR-NV-----AD-F---AGR---VD-N-LPIL----LSA--
Sequence 2 LEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEK

Sequence 1 VVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQI
           --LY-NA---P-W----H---YVTRG---VQVV---G-----D-V--G--
Sequence 2 GNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEM

Sequence 1 LVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLA
           -VVPQ-------AG--G-EWV--K-------SP-AG-TSV-RA-P--V--
Sequence 2 FVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVIT

Sequence 1 NSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           NSY-IS---A--LK--R-----------R-----------
Sequence 2 NSYQISPNQAQALKMNRGSQSFLLSPGGRRS---------



Alignment 19
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 37.55 (202/538)
Sequence 1 MSTKLILSFS-LCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRL
           M-----LS-S-LCL--LS---------K----------------C----L
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSSK-------------LNECQLNNL

Sequence 1 TASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A-EP--RV-SE-G----W----PE--CAG-----------GL-LPSYS-
Sequence 2 NALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSP

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGES
           -P------QG-G--GV--PGCPETF------E-P--Q---R---------
Sequence 2 YPRMIIIAQGKGALGVAIPGCPETF------EEPQEQSNRRG--------

Sequence 1 SRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPS
           SR------Q------------------------D-HQKI-----GDV---
Sequence 2 SRSQKQQLQ------------------------DSHQKIRHFNEGDVLVI

Sequence 1 PAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSK-QSRE
           P-GV--WT-N-GD-----I-L-D---F-NQLD---R-F-LAG-------E
Sequence 2 PPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPE

Sequence 1 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE
           ----Q-Q----G---Q----Q--E-------LSGF----L---F-N----
Sequence 2 TMQQQQQQKSHGGRKQGQHQQEEEEE-GGSVLSGFSKHFLAQSF-NTNED

Sequence 1 TISKLRGENDQRGFIVQAR-----------------------DLKLRVP-
           ---KL----D-R--IV--------------------------D-----P-
Sequence 2 IAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPS

Sequence 1 ------------------------------------------EEYEEELQ
           -------------------------------------------E-E-E-Q
Sequence 2 HPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQ

Sequence 1 -----------------RERGDRKRGGSGRSNGLEQAFCNLKFRQNVNRP
           -----------------R----R-RG---R-NG-E---C-LK---N--RP
Sequence 2 PRKSREWRSKKTQPRRPRQEEPRERGCETR-NGVEENICTLKLHENIARP

Sequence 1 SRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNA
           SRAD--NP-AGRI-T--S--LP-L---QLSAQ-VVLYKN-I--P-WNLNA
Sequence 2 SRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNA

Sequence 1 HSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREG
           -S--YVTRG-G-V-VV---G--VFD----RGQ-LVVPQ-F-V---AG--G
Sequence 2 NSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQG

Sequence 1 LEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGR
           -E----K---NA-TS-------V-RAIP-EVLA-SY---------LK---
Sequence 2 FEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQVSELKYEG

Sequence 1 QEVEVFRPFQSRDEKERERFSIV
           -------P---------------
Sequence 2 NWGPLVNPESQQGSPRVKVA---



Alignment 20
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 34.39 (185/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           ----------L----------LL---------------Q----C----L-
Sequence 2 -------MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLD

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           ---P-----SEAG--E-WDH--P--RCAG----R-VIQ-GGL-LP-----
Sequence 2 VLQPTEVIKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSS

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRD-QRSRQSESGES
           P-I--V-QG-G--G-V-PGC-ETF-----------Q---Q---Q---G--
Sequence 2 PFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQGQQ

Sequence 1 SRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPS
           ----Q---Q----------Q---Q-------R-D-HQK----R-GD-I--
Sequence 2 GQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFR-DMHQKVEHVRHGDAIAM

Sequence 1 PAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRED
           --G--QW--N-GD--LI---L-D----QNQLD-N-R-F-LAG---Q----
Sequence 2 TPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQ----

Sequence 1 RRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQET
           ----------GS--Q----Q--------NILSGF----L-------D---
Sequence 2 ----------GSSQQQQQQQQ-------NILSGFDPQVLAQALK-IDVRL

Sequence 1 ISKLRGENDQRGFIVQARD--LKLRVPEEYEEELQRERGDRKRGGSGRSN
           ---L----D-RG-IV---------R-P-----E----R--R----S---N
Sequence 2 AQELQNQQDKRGNIVRVKGPFQVVRPPLRQAYESEQWRHPRGPPQSPQDN

Sequence 1 GLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQ
           GLE---C------N---P-RAD---P--GR---V-S--LPIL--I-LSA-
Sequence 2 GLEETICSMRTHENIDDPARADIYKPNLGRVTSVNSYTLPILQYIRLSAT

Sequence 1 HVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQ
           ---L---A---P--N-NA---LY-T-G--R-QVV-D-G--V-D--VQ-GQ
Sequence 2 RGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQ

Sequence 1 ILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVL
           --V-PQGFA-V--------EW---K---NA--S--AG-TS-LRA-P-EV-
Sequence 2 LVVIPQGFAYVVQS-QNNFEWISFKTNANAMISTLAGRTSALRALPLEVI

Sequence 1 ANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV
           -N-Y-IS--EA---K----E----R----------E----V
Sequence 2 TNAYQISLEEARKIKFNTLETTLTRARGGQQPQLIEEIVEV



Alignment 21
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 35.32 (190/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           -------------------------------------Q-----C--QRL-
Sequence 2 -----------------------------------RQQPEENACQFQRLN

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P---F--QGRG--G---PGCP---------E-P--Q-----R-S-S----
Sequence 2 PQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ----GRRSQSQRPP

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           R--Q------------G---S-Q---------D-HQK--R---GD-I--P
Sequence 2 RRLQ------------GEDQSQQQR-------DSHQKVHRFDEGDLIAVP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQS-------
           -GV--W--N--D-D-----L-D-N---NQLD---R-F-LAG---------
Sequence 2 TGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY

Sequence 1 -KQSREDRRS---------QRQTREEGSD--------RQSRESQDDEALL
           --QSR--RR----------Q-Q-R-E-----------R--R--Q--E---
Sequence 2 QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENE-

Sequence 1 EANILSGFEDEILQEIFRNVDQETISKLRGE--NDQRGFIVQARD-LKLR
           --NI-SGF--E-L---F---D------LRGE------G-IV--R--L---
Sequence 2 GGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRIL

Sequence 1 VP---------EEYEE-ELQRERGDRKRG-GS-GRSNGLEQAFCNLKFRQ
           -P---------EEY-E-E------DR-RG-GS-GR-NG-E---C------
Sequence 2 SPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKK

Sequence 1 NVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPR
           N--R----D--NP-AG---T----NL-IL-----SA----LY-NA-----
Sequence 2 NIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH

Sequence 1 WNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLK
           -N-NAHS--Y--RG---VQVV---G--V-D---Q-G--LVVPQ-FAV--K
Sequence 2 YNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGK

Sequence 1 AGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR
           ---E--E-V--K-D--------AG--SV----P-EV-ANSY------A--
Sequence 2 SQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQ

Sequence 1 LKNGRQEVEVFRPFQSRDEKERERFSIV
           LKN-------F-P---------------
Sequence 2 LKNN-NPFKFFVPPSQQSPRAVA-----



Alignment 22
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 35.32 (190/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           -------------------------------------Q-----C--QRL-
Sequence 2 --------------------------------ISFRQQPEENACQFQRLN

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P---F--QGRG--G---PGCP---------E-P--Q-----R-S-S----
Sequence 2 PQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ----GRRSQSQRPP

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           R--Q------------G---S-Q---------D-HQK--R---GD-I--P
Sequence 2 RRLQ------------GEDQSQQQR-------DSHQKVHRFDEGDLIAVP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQS-------
           -GV--W--N--D-D-----L-D-N---NQLD---R-F-LAG---------
Sequence 2 TGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY

Sequence 1 -KQSREDRRS---------QRQTREEGSD--------RQSRESQDDEALL
           --QSR--RR----------Q-Q-R-E-----------R--R--Q--E---
Sequence 2 QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENE-

Sequence 1 EANILSGFEDEILQEIFRNVDQETISKLRGE--NDQRGFIVQARD-LKLR
           --NI-SGF--E-L---F---D------LRGE------G-IV--R--L---
Sequence 2 GGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRIL

Sequence 1 VP---------EEYEE-ELQRERGDRKRG-GS-GRSNGLEQAFCNLKFRQ
           -P---------EEY-E-E------DR-RG-GS-GR-NG-E---C------
Sequence 2 SPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKK

Sequence 1 NVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPR
           N--R----D--NP-AG---T----NL-IL-----SA----LY-NA-----
Sequence 2 NIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH

Sequence 1 WNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLK
           -N-NAHS--Y--RG---VQVV---G--V-D---Q-G--LVVPQ-FAV--K
Sequence 2 YNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGK

Sequence 1 AGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR
           ---E--E-V--K-D--------AG--SV----P-EV-ANSY------A--
Sequence 2 SQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQ

Sequence 1 LKNGRQEVEVFRPFQSRDEKERERFSIV
           LKN-------F-P---------------
Sequence 2 LKNN-NPFKFFVPPSQQSPRAVA-----



Alignment 23
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 32.71 (176/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           ---------------------L---------------Q--Q--C-IQ-L-
Sequence 2 ----------------MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLN

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N-
Sequence 2 ALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNG

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P------QG-G--G---PGCP-T-Q---E-----SQ--QR-R--------
Sequence 2 PQEIYIQQGNGIFGMIFPGCPSTYQEPQE-----SQ--QRGRS-------

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           ---QR---------------------------D-HQK--R-R-GD-I--P
Sequence 2 ---QRPQ-------------------------DRHQKVHRFREGDLIAVP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR
           -GV--W--NN-D---------D-NS--NQLD---R-F-LAG---Q-----
Sequence 2 TGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKY

Sequence 1 RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI
           --Q-Q----GS--Q----Q--E-----NILSGF--E-L-E-F--V-----
Sequence 2 QQQQQG---GSQSQKGKQQEEENE-GSNILSGFAPEFLKEAF-GVNMQIV

Sequence 1 SKLRGENDQR--GFIVQARD-LK-----LRVPEEYE----EELQRERGDR
           --L-GEN-----G-IV-----L-------R-P---E----EE-Q------
Sequence 2 RNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVET

Sequence 1 KRG---GSGRS-NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSN
           --G----S-RS-NG-----C----RQN----S--D--NP-AG-I-T--S-
Sequence 2 DKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSL

Sequence 1 NLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDE
           --P-L----LSAQ---L-KNA---P---LNA-S--Y---G---VQVV---
Sequence 2 DFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCN

Sequence 1 GRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAG
           G--VFD---Q-G--L-VPQ-FAV--K------E-V--K--D-------AG
Sequence 2 GERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAG

Sequence 1 KTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERER
           --S-L-A-P-EV-----------A---KN---------P--S--------
Sequence 2 ANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA--

Sequence 1 FSIV
           ----
Sequence 2 ----



Alignment 24
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 32.71 (176/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           ---------------------L---------------Q--Q--C-IQ-L-
Sequence 2 ----------------MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLN

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N-
Sequence 2 ALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNG

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P------QG-G--G---PGCP-T-Q---E-----SQ--QR-R--------
Sequence 2 PQEIYIQQGNGIFGMIFPGCPSTYQEPQE-----SQ--QRGRS-------

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           ---QR---------------------------D-HQK--R-R-GD-I--P
Sequence 2 ---QRPQ-------------------------DRHQKVHRFREGDLIAVP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDR
           -GV--W--NN-D---------D-NS--NQLD---R-F-LAG---Q-----
Sequence 2 TGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKY

Sequence 1 RSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETI
           --Q-Q----GS--Q----Q--E-----NILSGF--E-L-E-F--V-----
Sequence 2 QQQQQG---GSQSQKGKQQEEENE-GSNILSGFAPEFLKEAF-GVNMQIV

Sequence 1 SKLRGENDQR--GFIVQARD-LK-----LRVPEEYE----EELQRERGDR
           --L-GEN-----G-IV-----L-------R-P---E----EE-Q------
Sequence 2 RNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVET

Sequence 1 KRG---GSGRS-NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSN
           --G----S-RS-NG-----C----RQN----S--D--NP-AG-I-T--S-
Sequence 2 DKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSL

Sequence 1 NLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDE
           --P-L----LSAQ---L-KNA---P---LNA-S--Y---G---VQVV---
Sequence 2 DFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCN

Sequence 1 GRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAG
           G--VFD---Q-G--L-VPQ-FAV--K------E-V--K--D-------AG
Sequence 2 GERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAG

Sequence 1 KTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERER
           --S-L-A-P-EV-----------A---KN---------P--S--------
Sequence 2 ANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA--

Sequence 1 FSIV
           ----
Sequence 2 ----



Alignment 25
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 32.90 (177/538)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRL
           ------L-FSLC----S-C-----------R--P-------Q--C-IQ-L
Sequence 2 ---MAKLVFSLCFLLFSGCCFAF-----SSREQPQ------QNECQIQKL

Sequence 1 TASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 NALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGES
           -P------QG-G--G---PGCP-TF------E-P--Q--QR------G-S
Sequence 2 GPQEIYIQQGKGIFGMIYPGCPSTF------EEPQ-QPQQR------GQS

Sequence 1 SRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPS
           SR-------------------------------D-HQKI---R-GD-I--
Sequence 2 SRPQ-----------------------------DRHQKIYNFREGDLIAV

Sequence 1 PAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRED
           P-GV--W--NN-D---------D-NS--NQLD---R-F-LAG---Q----
Sequence 2 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ----

Sequence 1 RRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQET
           -----Q----G---Q----Q--E------ILSGF--E-L---F--VD---
Sequence 2 EFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAF-SVDKQI

Sequence 1 ISKLRGEN--DQRGFIVQAR----------DLKLRVPEEYEEELQRE---
           ---L-GEN-----G-IV-------------D-----P-E-EEE---E---
Sequence 2 AKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ

Sequence 1 -RG-----DRKRGGSGRS--NGLEQAFCNLKFRQNVNRPSRADVFNPRAG
           --G------R-RG----S--NG-----C----R-N----S--D--NP-AG
Sequence 2 CKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAG

Sequence 1 RINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEG
           ---T--S---P-L----LSA----L-KNA---P--NLNA-S--Y---G--
Sequence 2 SVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRA

Sequence 1 RVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDN
           --QVV---G--VFD---Q-G--L-VPQ-F-V---------E-V--K--D-
Sequence 2 LIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDT

Sequence 1 AITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQS
           ------AG--S-L-A-P-EV-----------A---KN---------P--S
Sequence 2 PMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQES

Sequence 1 RDEKERERFSIV
           ------------
Sequence 2 QKRAVA------



Alignment 26
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 32.90 (177/538)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRL
           ------L-FSLC----S-C-----------R--P-------Q--C-IQ-L
Sequence 2 ---MAKLVFSLCFLLFSGCCFAF-----SSREQPQ------QNECQIQKL

Sequence 1 TASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 NALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGES
           -P------QG-G--G---PGCP-TF------E-P--Q--QR------G-S
Sequence 2 GPQEIYIQQGKGIFGMIYPGCPSTF------EEPQ-QPQQR------GQS

Sequence 1 SRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPS
           SR-------------------------------D-HQKI---R-GD-I--
Sequence 2 SRPQ-----------------------------DRHQKIYNFREGDLIAV

Sequence 1 PAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRED
           P-GV--W--NN-D---------D-NS--NQLD---R-F-LAG---Q----
Sequence 2 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ----

Sequence 1 RRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQET
           -----Q----G---Q----Q--E------ILSGF--E-L---F--VD---
Sequence 2 EFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAF-SVDKQI

Sequence 1 ISKLRGEN--DQRGFIVQAR----------DLKLRVPEEYEEELQRE---
           ---L-GEN-----G-IV-------------D-----P-E-EEE---E---
Sequence 2 AKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ

Sequence 1 -RG-----DRKRGGSGRS--NGLEQAFCNLKFRQNVNRPSRADVFNPRAG
           --G------R-RG----S--NG-----C----R-N----S--D--NP-AG
Sequence 2 CKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAG

Sequence 1 RINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEG
           ---T--S---P-L----LSA----L-KNA---P--NLNA-S--Y---G--
Sequence 2 SVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRA

Sequence 1 RVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDN
           --QVV---G--VFD---Q-G--L-VPQ-F-V---------E-V--K--D-
Sequence 2 LIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDT

Sequence 1 AITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQS
           ------AG--S-L-A-P-EV-----------A---KN---------P--S
Sequence 2 PMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQES

Sequence 1 RDEKERERFSIV
           ------------
Sequence 2 QKRAVA------



Alignment 27
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 36.62 (197/538)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT
           M---L-LSF--C--VL--S----------R--P----------C--QRL-
Sequence 2 MAKLLELSFCFCFLVLGASSISF------RQQPE------ENACQFQRLN

Sequence 1 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS
           P---F--QGRG--G---PGCP-T-------E-P--Q---R--QS------
Sequence 2 PQEIFIQQGRGYFGLIFPGCPSTY------EEPAQQ--GRRYQS------

Sequence 1 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP
           ---QR------EE----DQ---Q---------D-HQK--R---GD-I--P
Sequence 2 ---QRPPRRLQEE----DQSQQQQ--------DSHQKVHRFNEGDLIAVP

Sequence 1 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAG---------
           -GV--W--N--D-D-----L-D-N---NQLD---R-F-LAG---------
Sequence 2 TGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRY

Sequence 1 --QSKQSRE-------------DRRSQRQTREEGS-DRQSRESQDDEALL
           --QS-QSR---------------RR--R--R--G---R--R--Q--E---
Sequence 2 QQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDE-

Sequence 1 EANILSGFEDEILQEIFRNVDQETISKLRGEND--QRGFIVQARD-LKLR
           --NI-SGF--E-L---F---D------L-GEN-----G-IV--R--L---
Sequence 2 GGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRIL

Sequence 1 VP---------EEYEE---ELQRERGDRKRGGSGRSNGLEQAFCNLKFRQ
           -P---------EEY-E---E-----G-R-RG--G--NG-E---C------
Sequence 2 SPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKK

Sequence 1 NVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPR
           N-----------P-----------NL-IL----LSA----LY-NA---P-
Sequence 2 NIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPH

Sequence 1 WNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLK
           -N-NAHS--Y--RG---VQVV---G--V-D---Q-G--LVVPQ-FAV--K
Sequence 2 YNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGK

Sequence 1 AGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR
           ---E--E-V--K-D--------AG--S-----P-EV-ANSY------A--
Sequence 2 SQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQ

Sequence 1 LKNGRQEVEVFRPFQSRDEKERERFSIV
           LKN---------PFQ-------------
Sequence 2 LKNNNPFKFFVPPFQQSPRAVA------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.